PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG014427t1
Common NameTCM_014427
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family WRKY
Protein Properties Length: 291aa    MW: 33061.1 Da    PI: 8.4303
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG014427t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY44.62.9e-14233288259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       dD y+Wr  G K   g++  rs+Y+C+ +g p++k v+rs  d++++ei+ + +Hnh+
  Thecc1EG014427t1 233 DDAYSWRCIGIKGLIGNR-RRSFYKCARPGFPATKSVDRSL-DGQITEIIHKARHNHP 288
                       8***************97.6*********************.***************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.808.1E-12225288IPR003657WRKY domain
SuperFamilySSF1182906.15E-10227288IPR003657WRKY domain
SMARTSM007746.6E-7232289IPR003657WRKY domain
PROSITE profilePS5081110.831233290IPR003657WRKY domain
PfamPF031062.7E-9233288IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MELSSQTLKI IKGERQWWED MKWNDAEWGN RPDYLMHILS LLDKEKDAMT QLAEDRDLFE  60
VTMQNEGQQL GNSISFAYES TISMFSSYFT IPPAPELRPA KLSDPPPLMN AFNVLQSPFS  120
GELAAVSSNQ QSNTGNNQQS TIGREENNSS DVSCLSIAPP KPLFYFINDI STFSKHNSNL  180
LNNLLDLFKF RARLQARSFE EVAKQSQSKG NLQANYGNYY KQYSHLVKSR KSDDAYSWRC  240
IGIKGLIGNR RRSFYKCARP GFPATKSVDR SLDGQITEII HKARHNHPES *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021286255.12e-64probable WRKY transcription factor 34
TrEMBLA0A061G5C10.0A0A061G5C1_THECC; Uncharacterized protein
STRINGEOY222040.0(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.16e-16WRKY DNA-binding protein 4
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]