PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG014180t1
Common NameTCM_014180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 185aa    MW: 21953.8 Da    PI: 8.2018
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG014180t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM90.62.8e-28271552128
               NAM   2 ppGfrFhPtdeelvveyLkkkvegkk..leleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratk..sgyWkatgkdk 90 
                       p G+rF Ptdeelv++yL++kv +++   ++++ i+++++y+  P++   +++++e+ew+fF+++d + ++++++ r+++  +g+W++ g+ k
  Thecc1EG014180t1  27 PIGYRFMPTDEELVTHYLTNKVCRNPvpPSAFQEIRSTELYRKPPKSSV-QYSSGEREWFFFIHQDGNFEEQNKAIRIVEdgRGFWRTNGE-K 117
                       89***********************966556677***********9985.678899**************999999976645889**9998.8 PP

               NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +++++kg++   k+ L++++g  ++++kt+W m+eyrl
  Thecc1EG014180t1 118 PLFDTKGNVLAFKTHLMYFSGCLSNAKKTHWRMDEYRL 155
                       88888*******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-2919175IPR003441NAC domain
PROSITE profilePS5100530.50726177IPR003441NAC domain
PfamPF023653.8E-1927155IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MYVYTLFSLP SISMMEGHEE YFDDQFPIGY RFMPTDEELV THYLTNKVCR NPVPPSAFQE  60
IRSTELYRKP PKSSVQYSSG EREWFFFIHQ DGNFEEQNKA IRIVEDGRGF WRTNGEKPLF  120
DTKGNVLAFK THLMYFSGCL SNAKKTHWRM DEYRLPIQFY AQHNSKEQWA VGRLRRGREY  180
NLGF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-172515514140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017972565.11e-125PREDICTED: protein FEZ
TrEMBLA0A061G4R11e-137A0A061G4R1_THECC; Transcription factor, putative
STRINGEOY220241e-138(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2188055
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.11e-21NAC domain containing protein 32
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]