PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG014073t1
Common NameTCM_014073
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 359aa    MW: 40415.7 Da    PI: 8.5421
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG014073t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM181.71.8e-56161421129
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtdeel+++yL kkv + ++++ ++i evd++k+ePw+Lp k+k +ekewyfF+ rd+ky+tg r+nrat+sgyWkatgkdke++
  Thecc1EG014073t1  16 LPPGFRFHPTDEELISHYLYKKVLDINFSA-RAIGEVDLNKSEPWELPWKAKMGEKEWYFFCVRDRKYPTGLRTNRATDSGYWKATGKDKEIY 107
                       79**************************99.89***************888999*************************************** PP

               NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrle 129
                       + +++lvg+kktLvfykgrapkgekt+Wvmheyrle
  Thecc1EG014073t1 108 R-GKSLVGMKKTLVFYKGRAPKGEKTNWVMHEYRLE 142
                       *.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-6512166IPR003441NAC domain
PROSITE profilePS5100560.19716166IPR003441NAC domain
PfamPF023651.0E-2917141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MANITVIGQE DDQMDLPPGF RFHPTDEELI SHYLYKKVLD INFSARAIGE VDLNKSEPWE  60
LPWKAKMGEK EWYFFCVRDR KYPTGLRTNR ATDSGYWKAT GKDKEIYRGK SLVGMKKTLV  120
FYKGRAPKGE KTNWVMHEYR LEGKYSVHNL PKTAKNEWVI CRVFQKSSGG KKTHISGLVR  180
VGSFGNELGP SGLPPLMESS PYNGKSKPAV ESAYVPCFSN PIDVQRNQQD TTDNFNNPLL  240
PASSNPTDIF PRIPLSNAFY SNQAVPFPSN FQFPGSVLMQ DQSILRALIK NHGSNMRQDF  300
KTEREMVSVS QETGLTTDIN TEISSVVSNL EMGKRSFDGQ EAPSASAGPV DLDCFWHY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-5691727171NO APICAL MERISTEM PROTEIN
1ut4_B2e-5691727171NO APICAL MERISTEM PROTEIN
1ut7_A2e-5691727171NO APICAL MERISTEM PROTEIN
1ut7_B2e-5691727171NO APICAL MERISTEM PROTEIN
3swm_A2e-56917210174NAC domain-containing protein 19
3swm_B2e-56917210174NAC domain-containing protein 19
3swm_C2e-56917210174NAC domain-containing protein 19
3swm_D2e-56917210174NAC domain-containing protein 19
3swp_A2e-56917210174NAC domain-containing protein 19
3swp_B2e-56917210174NAC domain-containing protein 19
3swp_C2e-56917210174NAC domain-containing protein 19
3swp_D2e-56917210174NAC domain-containing protein 19
4dul_A2e-5691727171NAC domain-containing protein 19
4dul_B2e-5691727171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017972125.10.0PREDICTED: NAC domain-containing protein 100
SwissprotQ9FLJ21e-169NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A061FWI70.0A0A061FWI7_THECC; NAC domain protein, IPR003441
STRINGEOY219050.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40028174
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-172NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]