PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG012190t1
Common NameTCM_012190
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family LBD
Protein Properties Length: 188aa    MW: 20329.9 Da    PI: 7.3692
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG012190t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260144.53.1e-4510108199
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+kll++l +++reda++sl+yeAear+rdPvyG+vg i+ lq+q+++l++e
  Thecc1EG012190t1  10 PCAACKFLRRKCMPGCIFAPYFPPEEPQKFANVHKIFGASNVTKLLNELLPHQREDAVNSLAYEAEARVRDPVYGCVGAISFLQRQVQRLQKE 102
                       7******************************************************************************************** PP

            DUF260  94 lallke 99 
                       l+++++
  Thecc1EG012190t1 103 LDAANA 108
                       *99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.8529110IPR004883Lateral organ boundaries, LOB
PfamPF031954.3E-4410107IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MASSSSYNSP CAACKFLRRK CMPGCIFAPY FPPEEPQKFA NVHKIFGASN VTKLLNELLP  60
HQREDAVNSL AYEAEARVRD PVYGCVGAIS FLQRQVQRLQ KELDAANADL IRYACNDIPT  120
ALPAPPGASS VQPLTPRHRP ADFNRRIGNE GAGGFYHPTG AFPLPYSFPW NDNSSGDIND  180
GGGEGGM*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007036350.11e-138Lateral organ boundaries domain family protein
SwissprotQ9FML46e-75LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A061FUD51e-138A0A061FUD5_THECC; Lateral organ boundaries domain family protein
STRINGPOPTR_0015s09370.11e-114(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.44e-75LBD family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]