PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG012077t1
Common NameTCM_012077
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family Dof
Protein Properties Length: 413aa    MW: 45578.4 Da    PI: 7.2698
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG012077t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.24.8e-40157217262
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                       +++alkcprCdst+tkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rknkk+ 
  Thecc1EG012077t1 157 HDQALKCPRCDSTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKKVA 217
                       6899******************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-29151211IPR003851Zinc finger, Dof-type
PfamPF027011.5E-33158215IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.189161215IPR003851Zinc finger, Dof-type
PROSITE patternPS013610163199IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MALHSSVNAT VSYSPSLFFF VKISFKNFTY EGICSNASIN ANSLADTNHF NPWISLSHLF  60
SSSSLFFCTL VPLSQVLVKR ERLLSREQLF SFEYLAFCLC WVGFVSMGLT SLQVCMDSSD  120
WLQGTIHEES GMDSSSPSGD MLACSRPLIE RRLRPPHDQA LKCPRCDSTH TKFCYYNNYS  180
LSQPRYFCKT CRRYWTKGGT LRNIPVGGGC RKNKKVASKK SNDQSANSNN PGSSSHNPTD  240
LHLSFPEMNL SHLNNMLGTH GANNNFMESK YNSLLENPRP IDFMESKLEA IVGSSRNYDF  300
MGNGELGMVG GLGDMGHGLA PNLHGLCSPY GMSLDGNGGT FLDTCQRIML PYDANADQHA  360
VDVKPNTKLL SLDWQDQGCS DAGKDTYGYL NNLGSWSGMM NNYGPSTTNP LV*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAPTransfer from AT5G62940Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017972331.10.0PREDICTED: dof zinc finger protein DOF5.6
TrEMBLA0A061FV520.0A0A061FV52_THECC; Dof-type zinc finger DNA-binding family protein isoform 1
STRINGEOY207320.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63742746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.12e-49Dof family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]