PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG011671t1
Common NameTCM_011671
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 285aa    MW: 32767 Da    PI: 8.5163
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG011671t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.61.4e-5491341128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtdeel+++yL+++++++++++ ++i+evdiyk++Pw+Lp k+  +e+ewyfFs+rd+ky++g r+nrat sgyWkatg+dk+++
  Thecc1EG011671t1   9 LPPGFRFHPTDEELIMYYLRNQAKSRPCPV-SIIPEVDIYKFDPWQLPDKAGFGENEWYFFSPRDRKYPNGVRPNRATVSGYWKATGTDKAIY 100
                       79****************************.89***************988899*************************************** PP

               NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       s +++ vg+kk Lvfykgr pkg ktdW+mheyrl
  Thecc1EG011671t1 101 S-GSKYVGVKKALVFYKGRPPKGIKTDWIMHEYRL 134
                       *.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.85E-675161IPR003441NAC domain
PROSITE profilePS5100561.6379161IPR003441NAC domain
PfamPF023654.1E-2710134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009825Biological Processmultidimensional cell growth
GO:0009835Biological Processfruit ripening
GO:0009908Biological Processflower development
GO:0010150Biological Processleaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MEGKASSDLP PGFRFHPTDE ELIMYYLRNQ AKSRPCPVSI IPEVDIYKFD PWQLPDKAGF  60
GENEWYFFSP RDRKYPNGVR PNRATVSGYW KATGTDKAIY SGSKYVGVKK ALVFYKGRPP  120
KGIKTDWIMH EYRLSDSRKQ ISKQNGSMRL DDWVLCRIYK KKHSGKVLDQ KVEESNTPIE  180
MIGYSNDASE SQQMLKFPRT CSLTHLLELD YMGSISHLLS ENTYNSSFDF PNNIGNTGTD  240
HHVEKLQLGE VPYEYSDSGK FQVNLSGNLY QQVCMNPMVY QFQQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-71916617170NO APICAL MERISTEM PROTEIN
1ut4_B3e-71916617170NO APICAL MERISTEM PROTEIN
1ut7_A3e-71916617170NO APICAL MERISTEM PROTEIN
1ut7_B3e-71916617170NO APICAL MERISTEM PROTEIN
3swm_A4e-71916620173NAC domain-containing protein 19
3swm_B4e-71916620173NAC domain-containing protein 19
3swm_C4e-71916620173NAC domain-containing protein 19
3swm_D4e-71916620173NAC domain-containing protein 19
3swp_A4e-71916620173NAC domain-containing protein 19
3swp_B4e-71916620173NAC domain-containing protein 19
3swp_C4e-71916620173NAC domain-containing protein 19
3swp_D4e-71916620173NAC domain-containing protein 19
4dul_A3e-71916617170NAC domain-containing protein 19
4dul_B3e-71916617170NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence and reduces fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. {ECO:0000269|PubMed:29760199}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00221DAPTransfer from AT1G69490Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. {ECO:0000269|PubMed:29760199}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007046037.10.0PREDICTED: NAC transcription factor 29
SwissprotK4BWV21e-127NAP1_SOLLC; NAC domain-containing protein 1
TrEMBLA0A061EHU20.0A0A061EHU2_THECC; NAC domain protein, IPR003441
STRINGEOY018690.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM77072641
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.11e-120NAC-like, activated by AP3/PI
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  2. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  3. Ma X, et al.
    The NAC Transcription Factor SlNAP2 Regulates Leaf Senescence and Fruit Yield in Tomato.
    Plant Physiol., 2018. 177(3): p. 1286-1302
    [PMID:29760199]