PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG011624t1
Common NameTCM_011624
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family WRKY
Protein Properties Length: 565aa    MW: 61013.3 Da    PI: 7.8816
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG011624t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY109.41.7e-34278334259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       dDgynWrKYGqK+vkgsefprsYY+Ct++gCpvkkkvers  d++v+ei+Y+g+Hnh+
  Thecc1EG011624t1 278 DDGYNWRKYGQKQVKGSEFPRSYYKCTHPGCPVKKKVERSL-DGQVTEIIYKGQHNHQ 334
                       8****************************************.***************8 PP

2WRKY107.37.6e-34457515159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC+v+k+ver+++dpk+v++tYeg+Hnh+
  Thecc1EG011624t1 457 LDDGYRWRKYGQKVVKGNPYPRSYYKCTTPGCNVRKHVERASTDPKAVITTYEGKHNHD 515
                       59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.4E-30273336IPR003657WRKY domain
SuperFamilySSF1182901.07E-26275336IPR003657WRKY domain
SMARTSM007744.2E-39277335IPR003657WRKY domain
PfamPF031061.7E-26278334IPR003657WRKY domain
PROSITE profilePS5081124.443278336IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.3E-37442517IPR003657WRKY domain
SuperFamilySSF1182901.05E-29449517IPR003657WRKY domain
PROSITE profilePS5081138.836452517IPR003657WRKY domain
SMARTSM007741.3E-39457516IPR003657WRKY domain
PfamPF031063.8E-26458515IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 565 aa     Download sequence    Send to blast
MAESQEQQHQ PSKTVASQRP TITPPPRPFT EALFNGGSGM MGFSPGPMTL VSNFFSDTDE  60
FKSFSQLLAG AMASPAAAAA AQRPNFPAPP PTTTTEEQGD VSGAVGAGDT GLRFRQNKPA  120
GLVIAQPPPM FTVPPGLSPA SLLESPGFSV FSPGAQEHTI FAILIYPLIP FVCCIVRSVC  180
ESSRASTRTE KGPFGMTHQQ ALAQVTAQAA QAQMQADYSS APAASLAQVS SFTASTTTNQ  240
QIPTSLPDSS VTRKEPSRVS HSDPRSQPAS FIVDKPADDG YNWRKYGQKQ VKGSEFPRSY  300
YKCTHPGCPV KKKVERSLDG QVTEIIYKGQ HNHQPPQSNK RAKDSGSLNG NPNNQGNSES  360
ASQHQGGNLN ILKEGTSAYS MSKKDHESSQ ATAEHLSGTS DSEEAGDNET VADEKDEDEP  420
DPKRRSTEYR VSEPASSHRT VTEPRIIVQT TSEVDLLDDG YRWRKYGQKV VKGNPYPRSY  480
YKCTTPGCNV RKHVERASTD PKAVITTYEG KHNHDVPAAK TSSHNTANSN ASQVRTQTVT  540
NSADFGNNSQ QRVAHLRLKE EQIT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-44278518878Probable WRKY transcription factor 4
2lex_A8e-44278518878Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00260DAPTransfer from AT2G03340Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salicylic acid and during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007045981.20.0PREDICTED: probable WRKY transcription factor 3
SwissprotQ9ZQ700.0WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLA0A061EBP00.0A0A061EBP0_THECC; WRKY DNA-binding protein 4, putative isoform 1
STRINGEOY018120.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15342792
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.11e-148WRKY DNA-binding protein 3
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  3. Aamir M, et al.
    Structural and Functional Insights into WRKY3 and WRKY4 Transcription Factors to Unravel the WRKY-DNA (W-Box) Complex Interaction in Tomato (Solanum lycopersicum L.). A Computational Approach.
    Front Plant Sci, 2017. 8: p. 819
    [PMID:28611792]