PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG011578t2
Common NameTCM_011578
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family WRKY
Protein Properties Length: 305aa    MW: 32945.2 Da    PI: 6.4065
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG011578t2genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.26.1e-32164221259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       +Dgy+WrKYGqK vk+s++prsYYrCt ++C+vkk+vers+edp++v++tYeg+H h+
  Thecc1EG011578t2 164 EDGYRWRKYGQKAVKNSPYPRSYYRCTNSKCTVKKRVERSSEDPTTVITTYEGQHCHH 221
                       8******************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.5E-33148222IPR003657WRKY domain
SuperFamilySSF1182909.15E-28155221IPR003657WRKY domain
PROSITE profilePS5081129.953158223IPR003657WRKY domain
SMARTSM007745.3E-37163222IPR003657WRKY domain
PfamPF031068.4E-25164221IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MEDKEGADPR NEFTSDSSWT LPGPDPVSDS VNYFFDRESS ILSEFGWNLQ PDQAEEIERF  60
GELDRTATRP DLAGNFSGSQ SSGAAAAAAA GSGSGTATNL SGSADVSTSN PSVSSSSSED  120
PPEKSTGSGG KPPEIPSKVR KKGQKRIRQP RFAFVTKSEV DHLEDGYRWR KYGQKAVKNS  180
PYPRSYYRCT NSKCTVKKRV ERSSEDPTTV ITTYEGQHCH HSVGFPRGGL ISHEAAFAGQ  240
LTPAISQFYY PGVQLHREIP PSITQSHQVP IDVGGSRALP EPTPQLPTDE GLLGDIVPPG  300
MRNR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-261562201074Probable WRKY transcription factor 4
2lex_A7e-261562201074Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00067PBMTransfer from AT1G69310Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021299838.10.0probable WRKY transcription factor 57
RefseqXP_021299839.10.0probable WRKY transcription factor 57
SwissprotQ9C9837e-76WRK57_ARATH; Probable WRKY transcription factor 57
TrEMBLA0A061EHJ30.0A0A061EHJ3_THECC; WRKY DNA-binding protein 57 isoform 1
STRINGEOY017490.0(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.21e-64WRKY DNA-binding protein 57
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Jiang Y,Qiu Y,Hu Y,Yu D
    Heterologous Expression of AtWRKY57 Confers Drought Tolerance in Oryza sativa.
    Front Plant Sci, 2016. 7: p. 145
    [PMID:26904091]
  4. Jiang Y,Yu D
    The WRKY57 Transcription Factor Affects the Expression of Jasmonate ZIM-Domain Genes Transcriptionally to Compromise Botrytis cinerea Resistance.
    Plant Physiol., 2016. 171(4): p. 2771-82
    [PMID:27268959]
  5. Huang KC,Lin WC,Cheng WH
    Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis.
    BMC Plant Biol., 2018. 18(1): p. 40
    [PMID:29490615]