PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG010965t1
Common NameTCM_010965
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family GRAS
Protein Properties Length: 616aa    MW: 67186.7 Da    PI: 5.9762
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG010965t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS462.72.1e-1412466051374
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       lv++L++cAeav++++l+la+al++++  las+++ +m+++a+yf+eALa+r++r        l p++  +++ s++l+++  f+e++P+lkf
  Thecc1EG010965t1 246 LVHALMACAEAVQQNNLNLAEALVKQVGFLASSQAGAMRKVATYFAEALARRIYR--------LYPQNPLDHSLSDVLHMH--FYETCPYLKF 328
                       689****************************************************........445555556688888885..********** PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrl 186
                       +h+taNqaIlea+eg++rvH+iDf+++qG+QWpaL+qaLa R +gpp++R+Tg+g+p++++++ l+e+g++La++Ae+++v+fe++ +va++l
  Thecc1EG010965t1 329 AHFTANQAILEAFEGKKRVHVIDFSMNQGMQWPALMQALALRGGGPPTFRLTGIGPPSHDNSDHLQEVGWKLAQLAETIHVEFEYRGFVANSL 421
                       ********************************************************************************************* PP

              GRAS 187 edleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                       +dl+ ++L+++p  gEa+aVn+v++lh+ll++++++++    vL++vk+++P++v++veqea+hn++ Fl+rf+e+l+yys+lfdsle ++  
  Thecc1EG010965t1 422 ADLDASMLDLRPseGEAVAVNSVFELHKLLARPGAIDK----VLSVVKQMKPEIVTIVEQEANHNGPVFLDRFTESLHYYSTLFDSLEGSV-- 508
                       ***********999****************99999988....************************************************7.. PP

              GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvs 369
                        s++++++++++lg++i+nvvaceg +r+erhe+l++Wr+rl++aGF +v+l+++a kqa++ll+ ++ +dgy vee++g+l+lgW++rpL++
  Thecc1EG010965t1 509 -SSQDKVMSEVYLGKQICNVVACEGVDRVERHEKLAHWRNRLGTAGFASVHLGSNAFKQASMLLALFAgGDGYGVEENNGCLMLGWHSRPLIA 600
                       .9999**************************************************************************************** PP

              GRAS 370 vSaWr 374
                       +SaW+
  Thecc1EG010965t1 601 TSAWK 605
                       ****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120411.7E-3646112IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011293.2E-3846119No hitNo description
PROSITE profilePS5098567.67220584IPR005202Transcription factor GRAS
PfamPF035147.3E-139246605IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0042176Biological Processregulation of protein catabolic process
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 616 aa     Download sequence    Send to blast
MKRDHHHLQT NPDPSTVGSS SVCGGSTTGK AKMWQDEVAQ QDCGMDELLA VLGYKVKTSD  60
MAEVAQKLEQ LEEVMCNVQD DGISHLASET VHYNPSDLST WLESMLSELN PPSAFDPVVA  120
AGPAAAATLD DSFLGPAESS TLTTLDFDNN NQKHQKKGRQ LFEEASCSDY DLKAIPGKAI  180
YSQKTQTHDS SSSSTQNNVV KSEKRLKSTS GSHSDIYPPP ASSYGIPAES TRPVVLVDSQ  240
ENGIRLVHAL MACAEAVQQN NLNLAEALVK QVGFLASSQA GAMRKVATYF AEALARRIYR  300
LYPQNPLDHS LSDVLHMHFY ETCPYLKFAH FTANQAILEA FEGKKRVHVI DFSMNQGMQW  360
PALMQALALR GGGPPTFRLT GIGPPSHDNS DHLQEVGWKL AQLAETIHVE FEYRGFVANS  420
LADLDASMLD LRPSEGEAVA VNSVFELHKL LARPGAIDKV LSVVKQMKPE IVTIVEQEAN  480
HNGPVFLDRF TESLHYYSTL FDSLEGSVSS QDKVMSEVYL GKQICNVVAC EGVDRVERHE  540
KLAHWRNRLG TAGFASVHLG SNAFKQASML LALFAGGDGY GVEENNGCLM LGWHSRPLIA  600
TSAWKLANKT AATAH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A6e-6824160414378Protein SCARECROW
5b3h_A5e-6824160413377Protein SCARECROW
5b3h_D5e-6824160413377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00611ChIP-seqTransfer from AT2G01570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017971822.10.0PREDICTED: DELLA protein GAIP-B
SwissprotQ8S4W70.0GAI1_VITVI; DELLA protein GAI1
TrEMBLA0A061EFF90.0A0A061EFF9_THECC; GRAS family transcription factor family protein
STRINGEOY010290.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83728121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.10.0GRAS family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]