PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG010433t1
Common NameTCM_010433
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family TALE
Protein Properties Length: 315aa    MW: 35566.9 Da    PI: 4.5633
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG010433t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox291.8e-092572912155
                       HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
          Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                       k +yp+++++  LA+++gL+++q+ +WF N+R ++
  Thecc1EG010433t1 257 KWPYPTEADKIALAESTGLDQKQINNWFINQRKRH 291
                       569*****************************885 PP

2ELK26.81.2e-09211232122
               ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                       +LK++Llr +++++++Lk EFs
  Thecc1EG010433t1 211 DLKDRLLRRFGSHISTLKLEFS 232
                       69*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.1E-2373117IPR005540KNOX1
PfamPF037907.6E-2375116IPR005540KNOX1
SMARTSM012562.0E-26123174IPR005541KNOX2
PfamPF037912.4E-25127173IPR005541KNOX2
SMARTSM011889.5E-5211232IPR005539ELK domain
PROSITE profilePS512139.446211231IPR005539ELK domain
PfamPF037892.8E-7211232IPR005539ELK domain
PROSITE profilePS5007112.698231294IPR001356Homeobox domain
SuperFamilySSF466891.28E-19232306IPR009057Homeodomain-like
SMARTSM003899.8E-14233298IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.9E-28236295IPR009057Homeodomain-like
CDDcd000866.78E-13240295No hitNo description
PfamPF059201.9E-17251290IPR008422Homeobox KN domain
PROSITE patternPS000270269292IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010073Biological Processmeristem maintenance
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MEEMYGFHST GEYADRALMS PENLILPSEY QAWLCSSGRI PMFGSDELIS AASAVSEAAS  60
ITPEIQREED MSSVIKAKIA SHPSYPRLLE AYIDCQKVGA PPEVASILDE ILRENDVNKR  120
DIVPTCLGTD PELDEFMETY CDMLVKYKSD LSRPFDEATT FLNKIEMQLR NLCTGASIQG  180
ASDEGAASSD EDLSGGEVDA QEAQPRSEDR DLKDRLLRRF GSHISTLKLE FSKKKKKGKL  240
PREARQTLLD WWNVHYKWPY PTEADKIALA ESTGLDQKQI NNWFINQRKR HWKPSESMQF  300
AVMDSLSGQF FTED*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5890395e-48JX589039.1 Gossypium hirsutum clone NBRI_GE23646 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007044712.10.0KNOTTED1-like homeobox gene 6
SwissprotQ84JS61e-163KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLA0A061EE170.0A0A061EE17_THECC; KNOTTED1-like homeobox gene 6
STRINGVIT_01s0127g00210.t011e-180(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8352785
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.11e-142KNOTTED1-like homeobox gene 6
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]