PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG008462t1
Common NameTCM_008462
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family LBD
Protein Properties Length: 133aa    MW: 14775.9 Da    PI: 9.0812
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG008462t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26067.14.1e-21553149
            DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkal 49
                      +CaaCk+lrrkC +dCv++pyfp+++ ++fa +hk+FGasnv kll++ 
  Thecc1EG008462t1  5 RCAACKYLRRKCHSDCVFSPYFPSNNLQRFASIHKIFGASNVAKLLQHN 53
                      6*********************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089114.334108IPR004883Lateral organ boundaries, LOB
PfamPF031955.1E-20552IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 133 aa     Download sequence    Send to blast
MNPGRCAACK YLRRKCHSDC VFSPYFPSNN LQRFASIHKI FGASNVAKLL QHNVELKPVN  60
GCVGLMFLLQ QQIHNAETQL AKIRAEIAVL KSNAHHSQIQ QFEDESDSNV FLPGRHSVAH  120
PGLFNQASFG FI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007043865.11e-94LOB domain-containing protein 23, putative
SwissprotP594672e-34LBD23_ARATH; LOB domain-containing protein 23
TrEMBLA0A061E5V72e-94A0A061E5V7_THECC; LOB domain-containing protein 23, putative
STRINGPOPTR_0012s13910.11e-39(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26620.11e-35LOB domain-containing protein 23
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]