PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG008255t4
Common NameTCM_008255
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family VOZ
Protein Properties Length: 454aa    MW: 50366.5 Da    PI: 5.3796
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG008255t4genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ437.32.1e-1342064231217
               VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwna. 92 
                       pppsaf+gpkcalwdctrpaqgs+w+ dycssfhatlalne++pg+tp+lrp+gi+lkd+ll++al+ak+qgk+vgip+cegaat+kspwna 
  Thecc1EG008255t4 206 PPPSAFMGPKCALWDCTRPAQGSDWYYDYCSSFHATLALNEDPPGMTPILRPGGISLKDNLLLDALRAKTQGKNVGIPQCEGAATMKSPWNAt 298
                       89*****************************************************************************************95 PP

               VOZ  93 aelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrl 185
                       aelfdlsllege irewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgg+krsyymdpqps+++ewhl+eyei+ +da+alyrl
  Thecc1EG008255t4 299 AELFDLSLLEGEIIREWLFFDKPRRAFESGNRKQRSLPDYSGRGWHESRKQVMKEFGGQKRSYYMDPQPSGQYEWHLFEYEIYGCDAFALYRL 391
                       69******************************************************************************************* PP

               VOZ 186 elklvdekksakgkvskdsladlqkklgrlta 217
                       elkl++ekks+k kvskdsladlqkk+grlta
  Thecc1EG008255t4 392 ELKLANEKKSPKVKVSKDSLADLQKKMGRLTA 423
                       ******************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 454 aa     Download sequence    Send to blast
MQNNSKNKCI SASHQLMVDN AKNRLNNLQE RFTDLQAARK EGRAGDVAVL EEQVYQSLRE  60
WKAELCAPSP ATSLLGGSLG SFSDDINRLL QLYEEEDDAS SPLKGPAVLK PETDVQSLNP  120
CNLPVVPEDY LVNHELQQHG LQGFDPCKVS TSALETTAVG NDINYQLDYH PFDLQQEFDH  180
GPLIGANGTE DCVKDASPNI LPNVSPPPSA FMGPKCALWD CTRPAQGSDW YYDYCSSFHA  240
TLALNEDPPG MTPILRPGGI SLKDNLLLDA LRAKTQGKNV GIPQCEGAAT MKSPWNATAE  300
LFDLSLLEGE IIREWLFFDK PRRAFESGNR KQRSLPDYSG RGWHESRKQV MKEFGGQKRS  360
YYMDPQPSGQ YEWHLFEYEI YGCDAFALYR LELKLANEKK SPKVKVSKDS LADLQKKMGR  420
LTAEVPGDDR SPGKGKTKAS KKADARNVSS AQD*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007043719.20.0PREDICTED: transcription factor VOZ1
SwissprotQ9SGQ01e-174VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A061EB770.0A0A061EB77_THECC; Vascular plant one zinc finger protein isoform 4
STRINGEOX995530.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM110602534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-166vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  4. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  5. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]