PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG008150t1
Common NameTCM_008150
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family SBP
Protein Properties Length: 236aa    MW: 26115.5 Da    PI: 8.8733
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG008150t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.28.5e-42112189178
                       --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
               SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                       +Cq+e+C+adls+ak+yhrrhkvCe hska+vvlv+g +qrfCqqCsrfh lsefDe+krsCrrrLa+hnerrrk+++
  Thecc1EG008150t1 112 CCQAENCTADLSDAKQYHRRHKVCENHSKAQVVLVAGFRQRFCQQCSRFHVLSEFDEAKRSCRRRLAGHNERRRKNST 189
                       6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.8E-33108174IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.3110187IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-38111191IPR004333Transcription factor, SBP-box
PfamPF031101.9E-31113186IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MELVVLTHPL FLSSFYSPLL LVASSPSFLL FCSFHSLHTD STCMEARGKQ KMGKGVKREA  60
DMESDDDGSE LQFGGSMEDD DKKRKNVVVL GGSAAAAGSG RKGLTGAGAM RCCQAENCTA  120
DLSDAKQYHR RHKVCENHSK AQVVLVAGFR QRFCQQCSRF HVLSEFDEAK RSCRRRLAGH  180
NERRRKNSTE SHGEGSGRKG TGTQLKDMIC GQVDDRGRIK LTIQETSTYE QFQIR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-36103186184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00634PBMTransfer from PK22320.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007043635.11e-174Squamosa promoter binding protein-like 4
SwissprotQ9S7A92e-46SPL4_ARATH; Squamosa promoter-binding-like protein 4
TrEMBLA0A061E5321e-174A0A061E532_THECC; Squamosa promoter binding protein-like 4
STRINGVIT_12s0028g03350.t016e-74(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.29e-48squamosa promoter binding protein-like 4
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]