PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG007700t1
Common NameTCM_007700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family TCP
Protein Properties Length: 264aa    MW: 26874.2 Da    PI: 10.3892
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG007700t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP122.35.5e-3829113388
               TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssg 88 
                       +kk +++++h+kv+gR+RR+R+++ caar+F+L++eLG+++d++tieWLl+qa+p+i+++tgt++++as++ ++s s+ ++++s +
  Thecc1EG007700t1  29 VKKPPSKDRHSKVDGRGRRIRMPIICAARVFQLTRELGHKSDGQTIEWLLRQAEPSIIAATGTGTTPASFS-TVSVSVRGGANSTS 113
                       79****************************************************************99777.33333333333332 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.7E-3334122IPR005333Transcription factor, TCP
PROSITE profilePS5136928.2093488IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MSNSEGGATN GAIMDPQRQQ APGNGSLVVK KPPSKDRHSK VDGRGRRIRM PIICAARVFQ  60
LTRELGHKSD GQTIEWLLRQ AEPSIIAATG TGTTPASFST VSVSVRGGAN STSLSSTISS  120
SSLDHKPLLG PTPFILGKRV RADDDNAGKD DSGVVSLGPG VGSIVGPAGT GGFWAVPARP  180
DFGQVWSFAP PPPPEMVVQT AAAAAAAAAA QQPAAAALFV QQQQAMGEAS AARVGNYLPG  240
HLNLLASLSG APGGSGRRDE DPR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00524DAPTransfer from AT5G23280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007043253.21e-164PREDICTED: transcription factor TCP21
SwissprotQ9FMX26e-98TCP7_ARATH; Transcription factor TCP7
TrEMBLA0A061E2200.0A0A061E220_THECC; TCP family transcription factor
STRINGEOX990840.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17822685
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23280.13e-70TCP family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]