PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG007543t2
Common NameTCM_007543
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 190aa    MW: 21916.1 Da    PI: 8.0418
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG007543t2genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM126.91.6e-39571751128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrF Ptdeelvv++L++k++  +++  +vi+++d+y ++Pw+L+ k+ ae ++wyf+s+r         +nr t++gyWk  g d++v+
  Thecc1EG007543t2  57 LPPGFRFYPTDEELVVHFLQRKAALLPCHP-DVIPDLDLYPYDPWELNGKALAEGNQWYFYSRRT--------QNRNTSNGYWKPMGIDEPVV 140
                       79*************************999.99**************977778899******984........58999*************** PP

               NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++++++vg+kk + fy g+ p g kt+W+m+eyrl
  Thecc1EG007543t2 141 NSSSKKVGMKKYFLFYIGEGPAGIKTNWIMQEYRL 175
                       *********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-4751180IPR003441NAC domain
PROSITE profilePS5100542.85857189IPR003441NAC domain
PfamPF023653.0E-2358175IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010089Biological Processxylem development
GO:0043067Biological Processregulation of programmed cell death
GO:0048367Biological Processshoot system development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
FFILLCFVSS LSYLFLSHTI NITHYKSFFF TILLFLELLS IAIGYISREM GDNNVNLPPG  60
FRFYPTDEEL VVHFLQRKAA LLPCHPDVIP DLDLYPYDPW ELNGKALAEG NQWYFYSRRT  120
QNRNTSNGYW KPMGIDEPVV NSSSKKVGMK KYFLFYIGEG PAGIKTNWIM QEYRLSDCDS  180
SSSRSSKRS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-375317513142NO APICAL MERISTEM PROTEIN
1ut4_B1e-375317513142NO APICAL MERISTEM PROTEIN
1ut7_A1e-375317513142NO APICAL MERISTEM PROTEIN
1ut7_B1e-375317513142NO APICAL MERISTEM PROTEIN
3swm_A2e-375317516145NAC domain-containing protein 19
3swm_B2e-375317516145NAC domain-containing protein 19
3swm_C2e-375317516145NAC domain-containing protein 19
3swm_D2e-375317516145NAC domain-containing protein 19
3swp_A2e-375317516145NAC domain-containing protein 19
3swp_B2e-375317516145NAC domain-containing protein 19
3swp_C2e-375317516145NAC domain-containing protein 19
3swp_D2e-375317516145NAC domain-containing protein 19
4dul_A1e-375317513142NAC domain-containing protein 19
4dul_B1e-375317513142NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ8018181e-117KJ801818.1 Gossypium hirsutum NAC transcription factor (XND1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007043034.11e-102PREDICTED: NAC domain-containing protein 104
SwissprotQ8GWK65e-62NC104_ARATH; NAC domain-containing protein 104
TrEMBLA0A061E3E21e-138A0A061E3E2_THECC; NAC domain-containing protein 18 isoform 2 (Fragment)
STRINGEOX988661e-139(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.13e-63xylem NAC domain 1
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  2. Zhao C, et al.
    XYLEM NAC DOMAIN1, an angiosperm NAC transcription factor, inhibits xylem differentiation through conserved motifs that interact with RETINOBLASTOMA-RELATED.
    New Phytol., 2017. 216(1): p. 76-89
    [PMID:28742236]
  3. Tang N, et al.
    Natural variation at XND1 impacts root hydraulics and trade-off for stress responses in Arabidopsis.
    Nat Commun, 2018. 9(1): p. 3884
    [PMID:30250259]