PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG006827t1
Common NameTCM_006827
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family TALE
Protein Properties Length: 681aa    MW: 74348.1 Da    PI: 6.242
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG006827t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.32.9e-094214581954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yp+ +++  LA+++gLt +qV++WF N R +
  Thecc1EG006827t1 421 FEHflHPYPKDSDKIMLARQTGLTRSQVSNWFINARVR 458
                       664459******************************88 PP

2BELL128.13e-41283354172
              BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       erqelq+k +kL s+l+eVd+rYkqy++q+q+v+ssF+++ag+g+akpYt+lAl++iSrhFrcL+dai +qi
  Thecc1EG006827t1 283 ERQELQSKLTKLSSMLDEVDRRYKQYYHQMQIVVSSFDVIAGCGAAKPYTALALQTISRHFRCLRDAINGQI 354
                       79********************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.0E-65207352IPR006563POX domain
PfamPF075261.3E-51213350IPR006563POX domain
PROSITE profilePS5007112.163399462IPR001356Homeobox domain
SMARTSM003891.0E-9402466IPR001356Homeobox domain
CDDcd000864.46E-13402463No hitNo description
SuperFamilySSF466892.95E-17403469IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.1E-29405468IPR009057Homeodomain-like
PfamPF059204.6E-18419458IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 681 aa     Download sequence    Send to blast
MATYYTGSNN QRDTASMIYL RESMPGSYPE APVLPVNTMM YMNSGSYSDA FAGNSQQQNN  60
CIEIQAVEAS DSTSQHQEIL SNLGGSRVGV HDFGTWRDGR NEMLVMHPMG GPASILHGGQ  120
SLQGQGLSLS LGTQIPSGIQ MPSMPYRNPN SGFASFLSPN QSLTGEGGSR NSSSRDEQSR  180
NAEYLAPGFS GGNQDSNKGD MSAYGMSSIA RTIPNSKYLK AAQQLLDEVV NVRKALKQPD  240
GEKNQSSQDR MKSSTDDDRG SKNVPSNQQE CSNNSPNELS HAERQELQSK LTKLSSMLDE  300
VDRRYKQYYH QMQIVVSSFD VIAGCGAAKP YTALALQTIS RHFRCLRDAI NGQIRVTRKN  360
LGEQDTSENS KGVGISRLRY VDQQLRQQRA LQQLGMMQQH AWRPQRGLPE SSVSILRAWL  420
FEHFLHPYPK DSDKIMLARQ TGLTRSQVSN WFINARVRLW KPMVEEMYKE EFADAEMDSN  480
SSSENAVKAT KGDTGTSEDR GEDLQQSGSS SATERCSTGQ LMDSKSDHVS DVEMAVPSTG  540
AGFQNVTRGE TETEYGLLKL REEQRPNVDD SNLLPDAIAH SGGGNDRFMA AAAAAYHMSE  600
LGRFGSGSGV SLTLGLQHCE GGSIPMSGGS HQSFVAVRGD GIYNPAASSV GAETADFECI  660
NPGNRQHRFS SSHLLHDFVA *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B6e-17408465158Homeobox protein Meis1
4xrs_A6e-17408465158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007042091.10.0BEL1-like homeodomain protein 6 isoform 1
RefseqXP_007042092.10.0BEL1-like homeodomain protein 6 isoform 1
TrEMBLA0A061DZU50.0A0A061DZU5_THECC; BEL1-like homeodomain protein 6 isoform 1
STRINGVIT_03s0038g00050.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28692563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.21e-137BEL1-like homeodomain 6
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]