PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG006499t1
Common NameTCM_006499
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 329aa    MW: 37862.2 Da    PI: 7.2353
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG006499t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM152.91.5e-47551813128
               NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                       pGfrFhPt+eel+++yL++ + gkkl+  +vi  ++iy+++PwdLp   k +e+ewyfF++rd+k+ +g r+nr+t++g+Wkatg+d++++s 
  Thecc1EG006499t1  55 PGFRFHPTEEELLDFYLRNMIYGKKLRY-DVIGFLNIYHHDPWDLPGLSKIGEREWYFFVPRDRKHGSGGRPNRTTENGFWKATGSDRKIVSL 146
                       9**************************9.99***************8778899*************************************997 PP

               NAM  96 ..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                          ++ +glkktLvfykgrap+g+ktdWvm+eyrl
  Thecc1EG006499t1 147 sdPKRIIGLKKTLVFYKGRAPRGSKTDWVMNEYRL 181
                       666778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100554.95753199IPR003441NAC domain
SuperFamilySSF1019412.88E-5754199IPR003441NAC domain
PfamPF023652.8E-2555181IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0010200Biological Processresponse to chitin
GO:0045792Biological Processnegative regulation of cell size
GO:0048281Biological Processinflorescence morphogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MQQHFSFCIF YLIHLQHILN QAENLKTNYS SIISLTTMSS CQSNIDDPNP EIGLPGFRFH  60
PTEEELLDFY LRNMIYGKKL RYDVIGFLNI YHHDPWDLPG LSKIGEREWY FFVPRDRKHG  120
SGGRPNRTTE NGFWKATGSD RKIVSLSDPK RIIGLKKTLV FYKGRAPRGS KTDWVMNEYR  180
LPDGHPLPKD IVLCKIYRKA TSLKVLEQRA ALEEESKAMN TSPSSPLSSL ETISFCSPKE  240
DVVPSISVPQ VVLKKEIEEE EAMVEEKRDG TAKENETPST SLQFPLGKEK LPELQLPKMT  300
DWNQDQFWTQ LTSPWFQNLT PYANILNF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-45471998168Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017970070.10.0PREDICTED: NAC domain-containing protein 72
SwissprotQ10S651e-100NAC22_ORYSJ; NAC domain-containing protein 22
TrEMBLA0A061DXR10.0A0A061DXR1_THECC; NAC domain containing protein 36
STRINGEOX975000.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38992860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.11e-118NAC domain containing protein 36
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  2. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]