PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG006453t1
Common NameTCM_006453
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family Nin-like
Protein Properties Length: 953aa    MW: 104513 Da    PI: 6.3382
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG006453t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.47.1e-29632682252
            RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       ek+isl++l++yF++++kdAAk++gvc+T+LKriCRq+GI RWP+Rkik++
  Thecc1EG006453t1 632 EKTISLQVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGITRWPSRKIKKV 682
                       799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF557811.57E-5392488IPR029016GAF domain-like
Gene3DG3DSA:3.30.450.402.0E-4393490IPR029016GAF domain-like
PROSITE profilePS5151917.359621702IPR003035RWP-RK domain
PfamPF020421.0E-24634682IPR003035RWP-RK domain
SuperFamilySSF542774.66E-25847940No hitNo description
Gene3DG3DSA:3.10.20.2401.5E-24852936No hitNo description
PROSITE profilePS5174528.685854937IPR000270PB1 domain
SMARTSM006661.7E-28854937IPR000270PB1 domain
CDDcd064072.24E-45855936No hitNo description
PfamPF005641.1E-18855936IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 953 aa     Download sequence    Send to blast
MDGDGGFTPN STFGNLSDAA MDLDFMDELL FEGCWLETSD GFNFTEPGPS SSSGPNDPSQ  60
CLPVSGSSTV PFTINSHPMH QGETERNVPP PPLPKIEDLS KSQSQNWAAA GTATSLSQPG  120
SFIVEGTELG SRWWIGPRAE SGSSSSVKER LMEAIGYLKE CTKDRDVLIQ IWVPVKREGK  180
HVLTTEGQPY SLNTNCKSLE IFRDVSKSYN FPAEEDSKES VGLPGRVYLG KLPEWTPDVR  240
FFRSDEYPRI NFAHKYNVGG SLALPVFERG SGTCLGVVEI VTTTQKINYR PELEHVCKAL  300
EAVDLRSSHN FSPPSVEGYN ELYQAALPEI VEVLRSVCKT YKLPLALTWA ACVNQRKSGC  360
RHSDENFYHC VSTVDAACLA DEGFWDFLEA CSEHHLFRGQ GIVGRAFTTN KQCFVTDITA  420
FSKTNYPLSH HARMFGLRGA VAIPLQSIFS GSVEFVLELF LPKDCHDSEE QKQMLNSLSS  480
FMRQACQSLH VVVDKELEEE VILPVKEMVV ASDGKSDKEE TQFRISCLKE NSPEESSWIA  540
HMMEAQQKGK GVSVSWEYQK EEPKEEFRVT THWEDTQLEL YNKQVLSDFG QLHQNAGTKT  600
SVEGGGGDSS SSGGHRLLAG KKAGGKRRTK MEKTISLQVL RQYFAGSLKD AAKSIGVCPT  660
TLKRICRQHG ITRWPSRKIK KVGHSLKKLQ LVIDSVQGAE GAIQIGSFYS SFPELSSPNF  720
SGNGPSSSLK ISNHSKPSET QLESGMFSQG AAAPKSPSSS GSQSSGSSTC CSTGAKQHST  780
SINALGSADG LTVEDPGGAL KRALSDVELH ALNQEEPKLL ARSQSHKTFG EHSSFETLPP  840
LPRSGGQNLR PGGAIRVKAT FGEVKIRFSL QPSWGFRDLQ QEIAKRFNRE DFSKIDLKYL  900
DDDNEWVLLT CDADLEECID IYKSSQTHTI KISLHPASHP NLGSSVGSTA PL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007041613.10.0Plant regulator RWP-RK family protein, putative isoform 1
SwissprotQ7X9B90.0NLP2_ARATH; Protein NLP2
TrEMBLA0A061DXA40.0A0A061DXA4_THECC; Plant regulator RWP-RK family protein, putative isoform 1
STRINGVIT_03s0038g03710.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19982777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]