PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG005007t1
Common NameTCM_005007
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 505aa    MW: 57026.6 Da    PI: 5.4146
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG005007t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM126.52.2e-3961302128
               NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                        +GfrF P dee+++++L kk+ g++ ++ + i+evd+++ ePw+Lp+   v+++ +ew fF k +k +   ++++r+t +gyWk+tg+d+e+
  Thecc1EG005007t1   6 DVGFRFLPPDEEIISFFLSKKIIGDNDRT-RNIREVDLLQQEPWELPAlsIVRSRYQEWLFFYKLNKIS--HRKTERTTPAGYWKSTGQDREI 95 
                       58************************888.78***************4446777888**9999998875..46999***************** PP

               NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                        + +g+l+g+kktLvfy+gr+p+g+ktdWv+heyr+
  Thecc1EG005007t1  96 RD-GGRLIGTKKTLVFYEGRTPRGVKTDWVIHEYRA 130
                       *9.*******************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.8E-414137IPR003441NAC domain
PROSITE profilePS5100542.8225151IPR003441NAC domain
PfamPF023655.3E-197129IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 505 aa     Download sequence    Send to blast
MNIVLDVGFR FLPPDEEIIS FFLSKKIIGD NDRTRNIREV DLLQQEPWEL PALSIVRSRY  60
QEWLFFYKLN KISHRKTERT TPAGYWKSTG QDREIRDGGR LIGTKKTLVF YEGRTPRGVK  120
TDWVIHEYRA TADFVPPNAE KSYVVGLLRN KAAEKTENST SINGQINGQP SSHLAASSSQ  180
NNSVGVTHME VAPLPQSNSM DYEIALQTQL EYEGIFDYDL NDQSRMEEEG ITLEDIPSSN  240
DLDYDDESEW RLQFDTIEPE KDFMTSMFPD QDDGFYAETG YPLRPNYGAP GFAEDSSDTD  300
LEQANAWCDQ IVHHMSDGTG RGRSEGFYQK RMETGFHHDE VLIMDSSVDS ATVTAYEINC  360
LESVLEGKSV TRTCKSQYEP RSHKSVVQGH PRRVQLQGRS SGKAVSRDKA RESGVRGPVV  420
KLARNKKSIV QSNKDPKMDR DKNTQSDLIS RSKGSAGSSR KNSFNSVEMS QLSCKTNPPL  480
VYVGNVLLGV ILFIVVVWEV LFLH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-27512915139Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007051374.20.0PREDICTED: NAC domain-containing protein 62 isoform X1
TrEMBLA0A061DTW80.0A0A061DTW8_THECC; Uncharacterized protein
STRINGEOX955310.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2219545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49530.11e-40NAC domain containing protein 62
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]