PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG004843t1
Common NameTCM_004843
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family WRKY
Protein Properties Length: 328aa    MW: 36208.8 Da    PI: 7.0555
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG004843t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY108.43.5e-34177234259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       +Dgy+WrKYGqK vk+s+fprsYYrCt+++C+vkk+vers +dp++v++tYeg+H+h+
  Thecc1EG004843t1 177 EDGYRWRKYGQKAVKNSPFPRSYYRCTTTSCNVKKRVERSFSDPSIVVTTYEGQHTHP 234
                       8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.8E-35161236IPR003657WRKY domain
SuperFamilySSF1182901.31E-29168236IPR003657WRKY domain
PROSITE profilePS5081131.777171236IPR003657WRKY domain
SMARTSM007741.1E-40176235IPR003657WRKY domain
PfamPF031061.0E-26177234IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0009733Biological Processresponse to auxin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MESKEGVKME DVMGNSSPFS DYIANSFPLQ SIFDLSEGEK MPLGFMELLG VQDMSITPLF  60
DMAQQVPSLA TQPPNPTSTK IDSPPEVFNQ PATPNSSSIS SASSEAVNDD PVKAEDQEED  120
QQETRKHDLK LMKNCWIFLA FGVCDGGSRL KPKKTNQKRQ REPRFAFMTK SEVDHLEDGY  180
RWRKYGQKAV KNSPFPRSYY RCTTTSCNVK KRVERSFSDP SIVVTTYEGQ HTHPSPVIPR  240
PGLGGSHLTS GISAGAAAAF GMPMQRTPSH YQQPFGNGLS PLSVGHIGSN INASFLHERR  300
FCTPGPSLLK DHGLLQDIIP SHMLKEE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-271692361077Probable WRKY transcription factor 4
2lex_A5e-271692361077Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00069PBMTransfer from AT2G47260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF6698501e-127KF669850.1 Gossypium hirsutum WRKY transcription factor 52 (WRKY52) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017983061.10.0PREDICTED: probable WRKY transcription factor 23
SwissprotO229004e-65WRK23_ARATH; WRKY transcription factor 23
TrEMBLA0A061DT910.0A0A061DT91_THECC; WRKY DNA-binding protein 23, putative
STRINGEOX953060.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61522647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.13e-66WRKY DNA-binding protein 23
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Guo D,Qin G
    EXB1/WRKY71 transcription factor regulates both shoot branching and responses to abiotic stresses.
    Plant Signal Behav, 2016. 11(3): p. e1150404
    [PMID:26914912]
  5. PrĂ¡t T, et al.
    WRKY23 is a component of the transcriptional network mediating auxin feedback on PIN polarity.
    PLoS Genet., 2018. 14(1): p. e1007177
    [PMID:29377885]