PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG002319t2
Common NameTCM_002319
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family GRAS
Protein Properties Length: 527aa    MW: 58882.8 Da    PI: 5.9722
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG002319t2genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS455.82.7e-1391565261374
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       l+++L++cA+avs++dl + q+l+ +l+ ++s +g+p+qRl ay++e+L arla+s+s++ykal+++e +   s++ l+++++++ev+P++kf
  Thecc1EG002319t2 156 LKQVLVSCAKAVSDNDLMMSQWLMDELRRMVSVSGEPIQRLGAYMLEGLVARLASSGSSIYKALRCKEPA---SADLLSYMHILYEVCPYFKF 245
                       5799*****************************************************************9...9******************* PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvak 184
                       +++ aN aI ea++ e+rvHiiDf+i+qG QW++L+qa+a+Rp+gpp++ iTg+++++s   +   l+ +g+rL+k+Ae+++vpfef++ +a 
  Thecc1EG002319t2 246 GYMSANGAIAEAMKDEDRVHIIDFQIGQGSQWITLIQAFAARPGGPPHICITGIDDSTSAyaRGGGLNIVGKRLSKLAEHFKVPFEFHA-AAM 337
                       ********************************************************998899999************************.899 PP

              GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                       +  +++ e+Lrv+pgEalaVn++++lh+++desvs+e++rd++L+lvkslsPkvv++veqe+++n+++F+ rfle+l+yy+a+f+s++++lpr
  Thecc1EG002319t2 338 SGCEVQQEHLRVRPGEALAVNFAFMLHHMPDESVSTENHRDRLLRLVKSLSPKVVTLVEQESNTNTAPFFPRFLETLNYYTAMFESIDVTLPR 430
                       999****************************************************************************************** PP

              GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsv 370
                       + +eri+vE+++l+r++vn++aceg er+erhe ++kWr+r+++aGF p+pls+ +++++k+ll+++ +  yr+ee++g+l+lgW++r Lv+ 
  Thecc1EG002319t2 431 DRKERINVEQHCLARDVVNIIACEGPERVERHELMGKWRSRFRMAGFCPYPLSSLVNATIKTLLENYCD-KYRLEERDGALFLGWMNRDLVAS 522
                       *******************************************************************95.5********************** PP

              GRAS 371 SaWr 374
                       +aW+
  Thecc1EG002319t2 523 CAWK 526
                       ***8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098569.205130507IPR005202Transcription factor GRAS
PfamPF035149.3E-137156526IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007165Biological Processsignal transduction
GO:0009640Biological Processphotomorphogenesis
GO:0005737Cellular Componentcytoplasm
GO:0004871Molecular Functionsignal transducer activity
Sequence ? help Back to Top
Protein Sequence    Length: 527 aa     Download sequence    Send to blast
MASRLYHQVK QEVEPYCLPQ FPTIDRSLCY SDSSQGSHFS VKNSSELYCT LESSSANGSY  60
TVYNSSSTVS FSPNGSPMSQ QESQSYPSDL HHSPDNTYGS PISGSCITDD VSDLRHKLRE  120
LETVMLGPDS DIIDSTTSPD MGSWNLVMDA ISRGDLKQVL VSCAKAVSDN DLMMSQWLMD  180
ELRRMVSVSG EPIQRLGAYM LEGLVARLAS SGSSIYKALR CKEPASADLL SYMHILYEVC  240
PYFKFGYMSA NGAIAEAMKD EDRVHIIDFQ IGQGSQWITL IQAFAARPGG PPHICITGID  300
DSTSAYARGG GLNIVGKRLS KLAEHFKVPF EFHAAAMSGC EVQQEHLRVR PGEALAVNFA  360
FMLHHMPDES VSTENHRDRL LRLVKSLSPK VVTLVEQESN TNTAPFFPRF LETLNYYTAM  420
FESIDVTLPR DRKERINVEQ HCLARDVVNI IACEGPERVE RHELMGKWRS RFRMAGFCPY  480
PLSSLVNATI KTLLENYCDK YRLEERDGAL FLGWMNRDLV ASCAWK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-6216352526378Protein SCARECROW
5b3h_A2e-6216352525377Protein SCARECROW
5b3h_D2e-6216352525377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phytochrome A (phyA) signal transduction. {ECO:0000269|PubMed:10817761}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007049286.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_007049287.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_017982760.10.0PREDICTED: scarecrow-like transcription factor PAT1
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLA0A061DLX80.0A0A061DLX8_THECC; GRAS family transcription factor isoform 1
STRINGEOX934420.0(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Heyman J, et al.
    The heterodimeric transcription factor complex ERF115-PAT1 grants regeneration competence.
    Nat Plants, 2016. 2(11): p. 16165
    [PMID:27797356]