PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG002318t2
Common NameTCM_002318
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family WRKY
Protein Properties Length: 504aa    MW: 54950.9 Da    PI: 6.5998
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG002318t2genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY97.96.4e-31107164260
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                       +DgynWrKYGqK vkg+ef rsYY+Ct+++C vkk++ers+ d+k+v+++Y g+H+h+k
  Thecc1EG002318t2 107 EDGYNWRKYGQKLVKGNEFVRSYYKCTHPNCLVKKQLERSH-DGKMVDTVYFGQHDHPK 164
                       7****************************************.***************85 PP

2WRKY103.41.2e-32281339159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ++Dgy+WrKYGqK vkg+++prsYYrC+ +gCpvkk+ver+++d k+v++tYeg+H+h+
  Thecc1EG002318t2 281 VNDGYRWRKYGQKLVKGNPNPRSYYRCSNPGCPVKKHVERDSHDVKLVITTYEGRHDHD 339
                       58********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.824101165IPR003657WRKY domain
Gene3DG3DSA:2.20.25.807.6E-27102165IPR003657WRKY domain
SuperFamilySSF1182901.12E-24103165IPR003657WRKY domain
SMARTSM007741.7E-35106164IPR003657WRKY domain
PfamPF031061.1E-23107163IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.4E-35267341IPR003657WRKY domain
SuperFamilySSF1182901.22E-28273341IPR003657WRKY domain
PROSITE profilePS5081135.714276341IPR003657WRKY domain
SMARTSM007742.2E-37281340IPR003657WRKY domain
PfamPF031062.3E-25282338IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 504 aa     Download sequence    Send to blast
MVSSGECITD EVGTDKLQSP DAGNHALQQI SDSKVHLPQS NQGGETPSIK SEKAPLPDSM  60
VQTSKSEQGG NVSCMISNKT SVTPDMTPSP LPGTEGSTPI VREKASEDGY NWRKYGQKLV  120
KGNEFVRSYY KCTHPNCLVK KQLERSHDGK MVDTVYFGQH DHPKPLNLPV AVGVVVSVVE  180
EKPYNASPTV VKDKSSDARS QTPCQIEPQD DFRPLAIAAS ENVKGAPSKS IRIQNVADSD  240
DDHVISKRRK KENSNADASP VEKQTTESRM VVKTLSEVDI VNDGYRWRKY GQKLVKGNPN  300
PRSYYRCSNP GCPVKKHVER DSHDVKLVIT TYEGRHDHDI PPTRTVTHNT TGVNVHSAAH  360
NDESGTKVEE SETACVDMVV HSSSGLENKS SEQLNGESTT KSEASGAVCV DVVEAPISGP  420
ESGSNEQRSG KLQPSKRSKG DGNDMIVHSK SISQNTAKEQ LSNKLETKSE NDTVCIDKMV  480
HITPHPECNF DEQRMPSAEP VQS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A1e-37108342175WRKY transcription factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Binds to a 5'-CGTTGACCGAG-3' consensus core sequence which contains a W box, a frequently occurring elicitor-responsive cis-acting element. {ECO:0000269|PubMed:8972846}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00094SELEXTransfer from AT2G04880Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salicylic acid (SA). {ECO:0000269|PubMed:17264121}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007049282.20.0PREDICTED: WRKY transcription factor 1
RefseqXP_007049283.20.0PREDICTED: WRKY transcription factor 1
RefseqXP_007049284.20.0PREDICTED: WRKY transcription factor 1
SwissprotQ9SI373e-95WRKY1_ARATH; WRKY transcription factor 1
TrEMBLA0A061DMX70.0A0A061DMX7_THECC; Zinc-dependent activator protein-1, putative isoform 1
STRINGEOX934400.0(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04880.25e-96zinc-dependent activator protein-1
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Qiao Z,Li CL,Zhang W
    WRKY1 regulates stomatal movement in drought-stressed Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 91(1-2): p. 53-65
    [PMID:26820136]
  4. Aamir M, et al.
    Structural and Functional Insights into WRKY3 and WRKY4 Transcription Factors to Unravel the WRKY-DNA (W-Box) Complex Interaction in Tomato (Solanum lycopersicum L.). A Computational Approach.
    Front Plant Sci, 2017. 8: p. 819
    [PMID:28611792]