PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG001885t1
Common NameTCM_001885
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family WRKY
Protein Properties Length: 317aa    MW: 34966.4 Da    PI: 7.6362
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG001885t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.91e-33177234259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       +Dgy+WrKYGqK vk+s++prsYYrCts++C+vkk+vers +dp+vv++tYeg+Hnh+
  Thecc1EG001885t1 177 EDGYRWRKYGQKAVKNSPYPRSYYRCTSQKCTVKKRVERSFQDPSVVITTYEGQHNHH 234
                       8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.5E-35161236IPR003657WRKY domain
SuperFamilySSF1182901.44E-29169236IPR003657WRKY domain
PROSITE profilePS5081132.581171236IPR003657WRKY domain
SMARTSM007742.1E-39176235IPR003657WRKY domain
PfamPF031063.9E-26177234IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MSSNEKKDLH HYDPFQGFNR STFPFFDDNP SMYNQAAAAL TAPTQNFQGF DPSYMSFTDC  60
LHGSVDYNSF SRAFDISCSS SDVVSPIDDS NCKKIGTADN SVGNITENPS TPNSSVSSSS  120
NEGAADEDSS KSKKDKQPKG AEDADDKSKK VNKPKKEKRQ REPRFAFLTK SEIDHLEDGY  180
RWRKYGQKAV KNSPYPRSYY RCTSQKCTVK KRVERSFQDP SVVITTYEGQ HNHHIPATLR  240
GNAAGVLSPS ILASSASMGP SFPHEFLSHL LPSTSNPGGD TNSLHYQGLA PHQQQLQVPD  300
YGLLQDLVSS FTRQAP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-291692371078Probable WRKY transcription factor 4
2lex_A3e-291692371078Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1155160KEKRQR
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007048873.20.0PREDICTED: probable WRKY transcription factor 71
SwissprotQ8VWJ23e-64WRK28_ARATH; WRKY transcription factor 28
TrEMBLA0A061DK580.0A0A061DK58_THECC; WRKY DNA-binding protein 28, putative
STRINGEOX930300.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15242693
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.15e-52WRKY DNA-binding protein 71
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Kim SH, et al.
    Characterization of a Novel DWD protein that participates in heat stress response in Arabidopsis.
    Mol. Cells, 2014. 37(11): p. 833-40
    [PMID:25358503]
  5. Zhao L, et al.
    KLU suppresses megasporocyte cell fate through SWR1-mediated activation of WRKY28 expression in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(3): p. E526-E535
    [PMID:29288215]