PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG001514t1
Common NameTCM_001514
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 201aa    MW: 23141.3 Da    PI: 4.3597
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG001514t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM104.21.7e-32101281128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrF Ptdeelv ++L +k+   +++  ++i+e+d++ ++Pw+L+ k+  + ++++fF++          +nr+ ++gyWk+  ++++++
  Thecc1EG001514t1  10 LPPGFRFCPTDEELVLHFLYPKALLLPCHP-NIIPELDLHLLHPWELNGKALLSGNHCFFFTQM--------MENRVLENGYWKQLDTEEPIF 93 
                       79*************************999.89**************966667889999*9986........4589***************** PP

               NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          g+++g+kk +vfy ++ap g +t+W+m+ey+l
  Thecc1EG001514t1  94 GGAGKKIGMKKFFVFYINEAPFGIETNWLMQEYHL 128
                       *********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-437157IPR003441NAC domain
PROSITE profilePS5100537.67310159IPR003441NAC domain
PfamPF023654.1E-2111128IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MEMKDGCINL PPGFRFCPTD EELVLHFLYP KALLLPCHPN IIPELDLHLL HPWELNGKAL  60
LSGNHCFFFT QMMENRVLEN GYWKQLDTEE PIFGGAGKKI GMKKFFVFYI NEAPFGIETN  120
WLMQEYHLCN WDSTLTSYKT TGNQKLDCSK WVLCRVEESK GNSQSFSYSD EDDGTELSCL  180
DEMFLSMDDD LDDISSSKFF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-32816415170NO APICAL MERISTEM PROTEIN
1ut4_B1e-32816415170NO APICAL MERISTEM PROTEIN
1ut7_A1e-32816415170NO APICAL MERISTEM PROTEIN
1ut7_B1e-32816415170NO APICAL MERISTEM PROTEIN
3swm_A1e-32816418173NAC domain-containing protein 19
3swm_B1e-32816418173NAC domain-containing protein 19
3swm_C1e-32816418173NAC domain-containing protein 19
3swm_D1e-32816418173NAC domain-containing protein 19
3swp_A1e-32816418173NAC domain-containing protein 19
3swp_B1e-32816418173NAC domain-containing protein 19
3swp_C1e-32816418173NAC domain-containing protein 19
3swp_D1e-32816418173NAC domain-containing protein 19
4dul_A1e-32816415170NAC domain-containing protein 19
4dul_B1e-32816415170NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007048423.21e-147PREDICTED: NAC domain-containing protein 104
SwissprotQ8GWK61e-56NC104_ARATH; NAC domain-containing protein 104
TrEMBLA0A061DJ461e-147A0A061DJ46_THECC; Xylem NAC domain 1, putative
STRINGEOX925801e-148(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36742862
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.19e-52xylem NAC domain 1
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  2. Zhao C, et al.
    XYLEM NAC DOMAIN1, an angiosperm NAC transcription factor, inhibits xylem differentiation through conserved motifs that interact with RETINOBLASTOMA-RELATED.
    New Phytol., 2017. 216(1): p. 76-89
    [PMID:28742236]
  3. Tang N, et al.
    Natural variation at XND1 impacts root hydraulics and trade-off for stress responses in Arabidopsis.
    Nat Commun, 2018. 9(1): p. 3884
    [PMID:30250259]