PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG001450t1
Common NameTCM_001450
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 349aa    MW: 38360.4 Da    PI: 4.4432
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG001450t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM157.55.7e-4961341129
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                       l+pGfrFhPtd elv++yL++kv gkkl + e+i+e+diyk+ PwdLp+  ++k+++ +w+fF++ +kkya+g r nrat  gyWk+tgkd++
  Thecc1EG001450t1   6 LAPGFRFHPTDVELVKYYLERKVLGKKLAF-EAIAELDIYKYAPWDLPAfsCLKTGDLKWFFFCPIEKKYARGARLNRATMYGYWKTTGKDRT 97 
                       579************************999.89***************4458889999*********************************** PP

               NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                       v+  k+++vg+ ktLvf++g+ap+g +tdWvmheyrle
  Thecc1EG001450t1  98 VTY-KDAVVGMIKTLVFHQGKAPHGDRTDWVMHEYRLE 134
                       ***.8999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.22E-564156IPR003441NAC domain
PROSITE profilePS5100552.6716156IPR003441NAC domain
PfamPF023652.2E-258133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MGKNLLAPGF RFHPTDVELV KYYLERKVLG KKLAFEAIAE LDIYKYAPWD LPAFSCLKTG  60
DLKWFFFCPI EKKYARGARL NRATMYGYWK TTGKDRTVTY KDAVVGMIKT LVFHQGKAPH  120
GDRTDWVMHE YRLEEKELAD RGVVQDTYVL CVVFKKDGMG PRNGAQYGAP FKEEDWSDDE  180
DVNLVGTGFL SGMSTLAIGG ASILCAPESL CAGASVASSG LYTVPRVVHT NAAASITTVI  240
DSNANAAPTV VDAPQVPVVV DKAVPASTEA PQLAQGPQVQ ELNDDIVSML EFFREDDAFI  300
MYDNGQVTGT ANDSFFEAPQ VSDDDDISSM LAFFTEDDNL NCVLFPFE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-43615615168Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that binds specific DNA sequences on the promoter regions of target genes. {ECO:0000250|UniProtKB:Q9C8W9}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00583DAPTransfer from AT5G64060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT8899192e-66KT889919.1 Corchorus olitorius cultivar Sudan Green microsatellite JROm574 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007048346.20.0PREDICTED: NAC domain-containing protein 82
SwissprotQ9FY823e-96NAC82_ARATH; NAC domain-containing protein 82
TrEMBLA0A061DRB90.0A0A061DRB9_THECC; NAC domain containing protein 82, putative
STRINGEOX925030.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36922562
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64060.11e-97NAC domain containing protein 103
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Deeken R, et al.
    Identification of Arabidopsis thaliana phloem RNAs provides a search criterion for phloem-based transcripts hidden in complex datasets of microarray experiments.
    Plant J., 2008. 55(5): p. 746-59
    [PMID:18485061]
  3. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  4. Ohbayashi I, et al.
    Evidence for a Role of ANAC082 as a Ribosomal Stress Response Mediator Leading to Growth Defects and Developmental Alterations in Arabidopsis.
    Plant Cell, 2017. 29(10): p. 2644-2660
    [PMID:28899981]