PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG001282t1
Common NameTCM_001282
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family WRKY
Protein Properties Length: 227aa    MW: 25515.8 Da    PI: 8.592
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG001282t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.52.4e-32149207159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver aedp++v++tYeg+H h+
  Thecc1EG001282t1 149 LDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAEDPRMVITTYEGRHVHS 207
                       59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.9E-33134207IPR003657WRKY domain
SuperFamilySSF1182901.44E-28141208IPR003657WRKY domain
PROSITE profilePS5081129.356144209IPR003657WRKY domain
SMARTSM007749.8E-37149208IPR003657WRKY domain
PfamPF031063.3E-25150206IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901141Biological Processregulation of lignin biosynthetic process
GO:1904369Biological Processpositive regulation of sclerenchyma cell differentiation
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MSSSSQAMLN QGLFEEQEMP TQMGFFAFPA NLSCPAPLGC HQSLKAFSIE SADAPSAANL  60
TETLLSSATT AKHRDDSASD FGGPQLLSLQ RSSANFWAWG EVNECLGSKK IGVDDHLGVS  120
AMKMKRIKAR RKVREPRFCF KTMSDVDVLD DGYKWRKYGQ KVVKNTQHPR SYYRCTQDNC  180
RVKKRVERLA EDPRMVITTY EGRHVHSPSH DLEDSQAPSQ LNNFFW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-27140206874Probable WRKY transcription factor 4
2lex_A5e-27140206874Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF6698431e-170KF669843.1 Gossypium hirsutum WRKY transcription factor 116 (WRKY116) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007048165.11e-172PREDICTED: probable WRKY transcription factor 13
SwissprotQ9SVB74e-63WRK13_ARATH; Probable WRKY transcription factor 13
TrEMBLA0A061DJ421e-171A0A061DJ42_THECC; WRKY DNA-binding protein 13
STRINGEOX923221e-172(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61062746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39410.12e-52WRKY DNA-binding protein 13
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]