PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG001265t1
Common NameTCM_001265
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family WRKY
Protein Properties Length: 246aa    MW: 28142.8 Da    PI: 9.4714
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG001265t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY93.91.1e-29157215159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       +dDgy+WrKYG+K+vk+s++pr+YY+C+s gC+vkk++er+++d+++v++tY g Hnh+
  Thecc1EG001265t1 157 MDDGYKWRKYGKKSVKNSPNPRNYYKCSSGGCNVKKRIERDRDDTSYVITTYDGIHNHD 215
                       59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.3E-32144217IPR003657WRKY domain
SuperFamilySSF1182907.32E-27150217IPR003657WRKY domain
PROSITE profilePS5081131.238152217IPR003657WRKY domain
SMARTSM007748.9E-33157216IPR003657WRKY domain
PfamPF031061.3E-22158215IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MKQQLIKIKG KKKKERKDNS YFRSFKLLYK CIKWQHLCQT GFPCYTLSKT AVQLSFVMDF  60
SHENSNPNPS YTFFPESFDP MPEFELADYL MLDDCPFEED TSSQSMVSSE KGMGGANGFS  120
GATSRNTNII CKSGVRKNKL ELGNRVAFRT KSELEVMDDG YKWRKYGKKS VKNSPNPRNY  180
YKCSSGGCNV KKRIERDRDD TSYVITTYDG IHNHDSPYMV YYNQMPIVAP NAWNLRTSPP  240
SSSST*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A4e-25144217174WRKY transcription factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269|PubMed:21030507}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007048143.21e-139PREDICTED: probable WRKY transcription factor 51
SwissprotQ93WU91e-45WRK51_ARATH; Probable WRKY transcription factor 51
TrEMBLA0A061DIH40.0A0A061DIH4_THECC; WRKY DNA-binding protein 51, putative
STRINGEOX923000.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM57112747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.14e-48WRKY DNA-binding protein 51
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  2. Yan C, et al.
    Injury Activates Ca2+/Calmodulin-Dependent Phosphorylation of JAV1-JAZ8-WRKY51 Complex for Jasmonate Biosynthesis.
    Mol. Cell, 2018. 70(1): p. 136-149.e7
    [PMID:29625034]