PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG000560t1
Common NameTCM_000560
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family LBD
Protein Properties Length: 318aa    MW: 35012.1 Da    PI: 7.2019
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG000560t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.16.1e-4371061100
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +CaaCk+lrrkC+++Cv+apyfp ++p+kfanvhk+FGasnv kll++l+ ++reda++sl+yeAear+rdPvyG+vg+i+ lq++l+q++++
  Thecc1EG000560t1   7 PCAACKFLRRKCTQECVFAPYFPPDNPQKFANVHKVFGASNVAKLLNELNASQREDAVNSLAYEAEARLRDPVYGCVGLISILQHRLKQMQHD 99 
                       7******************************************************************************************** PP

            DUF260  94 lallkee 100
                       l  +k+e
  Thecc1EG000560t1 100 LYNAKKE 106
                       9998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.886107IPR004883Lateral organ boundaries, LOB
PfamPF031955.5E-437104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MSSSNSPCAA CKFLRRKCTQ ECVFAPYFPP DNPQKFANVH KVFGASNVAK LLNELNASQR  60
EDAVNSLAYE AEARLRDPVY GCVGLISILQ HRLKQMQHDL YNAKKELSTF IGPQAMLPIL  120
QPPAFLPQHV GNPSSSAVMQ HNMMPMMGIP TAAAVAAAAS HVGQLAIREP QQQQQIFEAQ  180
QQLAAAAAAR EQQEMFRGYE QQHHQDQQQE IVRFNSGFEG AGSVTATGFN QMTTAATMSP  240
SLALGSFDNP YQIQTQQQDH HHHSHGGHSL QAQLLLQPQQ VQPQQPAQQN QQQQTQQNQQ  300
QQQQRSGSEE GRSIGPC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007047171.10.0ASYMMETRIC LEAVES 2-like 1
SwissprotQ9FKZ31e-98LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A061DMY00.0A0A061DMY0_THECC; ASYMMETRIC LEAVES 2-like 1
STRINGPOPTR_0007s11460.11e-119(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM80082441
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.12e-88ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]