PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG000399t2
Common NameTCM_000399
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family GRAS
Protein Properties Length: 609aa    MW: 67286.5 Da    PI: 4.7326
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG000399t2genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS370.81.8e-1132416082374
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                        ++Ll+cA+  ++++ e+a + L rl+e  s+ gdp++R+a+yfteAL +r++r   +  k l+  +t+   s+e + ++k++++++P+ kf+
  Thecc1EG000399t2 241 LKALLDCARL-AESEPERAIKSLIRLRESISECGDPTERVAFYFTEALYSRVSR---QAEKRLTILDTT---SEEFTLSYKALNDACPYSKFA 326
                       689******5.556889999999*******************************...777778888887...89999**************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvak 184
                       hltaNqaIlea+e+++++Hi+Df+i qG+QW+aLlqaLa+R++g+p ++Ri g+ +p  g   + +l +tg+rL++fA+ l+++fef++ + +
  Thecc1EG000399t2 327 HLTANQAILEATERASKIHIVDFGIVQGVQWAALLQALATRSAGKPtQIRISGIPAPVLGksPASSLYATGNRLRDFAKLLDLNFEFEP-ILT 418
                       ******************************************77666*********998888999************************.799 PP

              GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                        +e+l+  ++rv+++E+laVn++lql++llde   + +   + L l ksl+Pk+v++ e ea++n+  F +rf +al+yysa+f+sle +lpr
  Thecc1EG000399t2 419 PIEELNELSFRVDQDEVLAVNFMLQLYNLLDEAPVTVE---TALLLAKSLNPKIVTLGEYEASLNRVGFENRFKNALRYYSAVFESLEPNLPR 508
                       ******************************88877777...899************************************************* PP

              GRAS 278 eseerikvErellgreivnvvacegae.rrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslv.lgWkdrpL 367
                       +s eri vEr llgr+i  v+  e+ e rrer+e +e+W++ le+aGF++v+ls++a +qa+ ll +++ s  y++ e++  ++ l W++ pL
  Thecc1EG000399t2 509 DSPERIQVERLLLGRRIAGVIGPEEVEkRRERMEDKEQWKNLLESAGFETVALSHYARSQARILLWNYNySSSYSLIESQPGFLsLAWNEVPL 601
                       **********************999887*****************************************9999**9999988888******** PP

              GRAS 368 vsvSaWr 374
                       ++vS+Wr
  Thecc1EG000399t2 602 LTVSSWR 608
                       ******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098560.396214586IPR005202Transcription factor GRAS
PfamPF035146.4E-111241608IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 609 aa     Download sequence    Send to blast
MAYMCADSGN LMAIAQQVIK QKQQQEQQQQ QHHHQQQQLL GLNPFSINPW PNTHHAVSNA  60
PNLGYGLSGP GFADPFQGDT GEGFQFPNIE HQSSGFRFPD FCGGAGGEFD SDEWMDSLMN  120
SGDSTDSSNL PSGCEAWQNN GDFGLYGADP FSACPNRLSV TCSPPSDLNR VIFSTEAQKN  180
PNSLQAQPQL STWAPSPPPP PPQVTVKETK ISAPPSQTPS INDVVGVSSA SPEAESAPPL  240
LKALLDCARL AESEPERAIK SLIRLRESIS ECGDPTERVA FYFTEALYSR VSRQAEKRLT  300
ILDTTSEEFT LSYKALNDAC PYSKFAHLTA NQAILEATER ASKIHIVDFG IVQGVQWAAL  360
LQALATRSAG KPTQIRISGI PAPVLGKSPA SSLYATGNRL RDFAKLLDLN FEFEPILTPI  420
EELNELSFRV DQDEVLAVNF MLQLYNLLDE APVTVETALL LAKSLNPKIV TLGEYEASLN  480
RVGFENRFKN ALRYYSAVFE SLEPNLPRDS PERIQVERLL LGRRIAGVIG PEEVEKRRER  540
MEDKEQWKNL LESAGFETVA LSHYARSQAR ILLWNYNYSS SYSLIESQPG FLSLAWNEVP  600
LLTVSSWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-1502396083375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development (By similarity). Involved in environmental abiotic stress resistance. May increase the expression of stress-responsive genes (PubMed:20616154). Binds DNA in vitro (By similarity). {ECO:0000250|UniProtKB:Q53K16, ECO:0000250|UniProtKB:Q9SCR0, ECO:0000269|PubMed:20616154}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by drought and high salt stresses, and down-regulated by gibberellic acid (GA) treatment, but not by plant hormone abscisic acid (ABA) application in leaves. Under the salt treatment, expression is induced quickly, and it peaks at 3 hours. Under the drought treatment, the expression is not induced immediately, but reaches its maximum at 3 hours. Under the GA treatment, the expression becomes weaker within 5 hours. {ECO:0000269|PubMed:20616154}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017969634.10.0PREDICTED: scarecrow-like protein 4
SwissprotA0A024B7I00.0SCL7_POPEU; SCARECROW-LIKE protein 7
TrEMBLA0A061DH770.0A0A061DH77_THECC; Chitin-inducible gibberellin-responsive protein, putative isoform 1
STRINGEOX911130.0(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66770.10.0GRAS family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]