PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG000097t1
Common NameTCM_000097
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family NAC
Protein Properties Length: 279aa    MW: 31651 Da    PI: 9.1629
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG000097t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM148.92.5e-46301581128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       l pGfrFhPt+eelv++yLk  + gk ++   +i  ++iyk++PwdLp +++ +e+ewyfF++r++++ +g ++nr+t++gyWkatg+d+++ 
  Thecc1EG000097t1  30 LLPGFRFHPTEEELVDYYLKGTAMGKIFHS-GIIGFLNIYKHNPWDLPGMAEIGEREWYFFVPRERRAGHGGKPNRTTETGYWKATGSDRHIR 121
                       579************************999.89***************888899*************************************** PP

               NAM  94 sk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +    +++vgl+ktLvfy+g+apkg++tdWvm+eyrl
  Thecc1EG000097t1 122 CPkePRKTVGLRKTLVFYTGKAPKGRRTDWVMNEYRL 158
                       98666778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-5320177IPR003441NAC domain
PROSITE profilePS5100552.41930177IPR003441NAC domain
PfamPF023651.6E-2532158IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MQEKQTRLYL TSVLLVSSFN MENVTPELAL LPGFRFHPTE EELVDYYLKG TAMGKIFHSG  60
IIGFLNIYKH NPWDLPGMAE IGEREWYFFV PRERRAGHGG KPNRTTETGY WKATGSDRHI  120
RCPKEPRKTV GLRKTLVFYT GKAPKGRRTD WVMNEYRLIS NTNIATEDIV LAKIYRKATS  180
LRVLEQRAEE LVRTSHQSLP SNGASQSNFD APLSLQGLDF GAERGEELFE AAKKELQKDA  240
NSEALTRVGS MPAAEPIMDW TSESVWAQLR SPSSYAMW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-472718017171NAC domain-containing protein 19
3swm_B3e-472718017171NAC domain-containing protein 19
3swm_C3e-472718017171NAC domain-containing protein 19
3swm_D3e-472718017171NAC domain-containing protein 19
3swp_A3e-472718017171NAC domain-containing protein 19
3swp_B3e-472718017171NAC domain-containing protein 19
3swp_C3e-472718017171NAC domain-containing protein 19
3swp_D3e-472718017171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007046550.20.0PREDICTED: NAC domain-containing protein 35
SwissprotQ10S652e-80NAC22_ORYSJ; NAC domain-containing protein 22
TrEMBLA0A061DFJ60.0A0A061DFJ6_THECC; NAC domain-containing protein, putative
STRINGEOX907070.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38992860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.16e-81NAC domain containing protein 36
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  2. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]