PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7DS_7B303CBAF.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family CAMTA
Protein Properties Length: 54aa    MW: 6471.37 Da    PI: 11.4274
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7DS_7B303CBAF.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-154.32.6e-171354377
                   CG-1 43 nrkkvryfrkDGyswkkkkdgktvrEdhekLKvgg 77
                           nr++ r+frkDGy w++kkdg+tv E+he+LK  +
  Traes_7DS_7B303CBAF.1  1 NRRVNRFFRKDGYAWRRKKDGRTVGEAHERLKSCQ 35
                           89******************************655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF038598.0E-12138IPR005559CG-1 DNA-binding domain
PROSITE profilePS5143724.385154IPR005559CG-1 DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 54 aa     Download sequence    Send to blast
NRRVNRFFRK DGYAWRRKKD GRTVGEAHER LKSCQQERVP PVRTSRTGCA CPFY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010239809.17e-16PREDICTED: calmodulin-binding transcription activator 4 isoform X1
RefseqXP_010239810.19e-16PREDICTED: calmodulin-binding transcription activator 4 isoform X2
TrEMBLW5B3X87e-34W5B3X8_WHEAT; Uncharacterized protein
STRINGBRADI5G08167.13e-15(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67310.12e-13Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]