PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7AL_AF1593775.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bHLH
Protein Properties Length: 148aa    MW: 17012.6 Da    PI: 8.4867
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7AL_AF1593775.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH23.41e-071381655
                           HHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
                    HLH 16 iNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55
                           +N+ +++Lr+l+P+a   + kKls  +++ ++ +YI +Lq
  Traes_7AL_AF1593775.1  1 LNQLYSTLRSLIPNA--DHTKKLSIPTTVCQVLDYIPELQ 38
                           69************7..35666***************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000832.90E-5142No hitNo description
SuperFamilySSF474597.07E-9153IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS508889.585137IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000108.2E-5138IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.107.9E-7153IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
LNQLYSTLRS LIPNADHTKK LSIPTTVCQV LDYIPELQKQ VEDLEKKKQE LTRAKCRERL  60
QRVKDNTGRI VSATPLDGNE IMVQVSLLSN MAASLPLSKC INVFENEGLH LISSSTFSTE  120
VNRTFYSFHF EVHFYMRPSF PVHTVLTW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004971295.15e-53PREDICTED: transcription factor ORG3-like
TrEMBLW5HA831e-108W5HA83_WHEAT; Uncharacterized protein
STRINGMLOC_36351.11e-52(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32803472
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56970.11e-22bHLH family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]