PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6AL_F5BFFCA3E.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GRF
Protein Properties Length: 185aa    MW: 19775.4 Da    PI: 9.9488
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6AL_F5BFFCA3E.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC79.62.9e-2593136144
                    WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                            d+epgrCrRtDGKkWRCs+++++++k+CE+H+hrg++rsrk++e
  Traes_6AL_F5BFFCA3E.1  93 DPEPGRCRRTDGKKWRCSKEAYPDSKYCEKHMHRGKNRSRKPVE 136
                            79***************************************998 PP

2QLQ64.33e-222156237
                    QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                           +FTa+Q+q+L++Q+l+yKy+a+++P+P++Ll+++++
  Traes_6AL_F5BFFCA3E.1 21 PFTATQWQELEHQALIYKYMASGVPIPSDLLLPLRR 56
                           9********************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.6E-112056IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.4252156IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.8E-162154IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.57393137IPR014977WRC domain
PfamPF088796.7E-2194136IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MMMMGGRAGA GGVGAGGGRC PFTATQWQEL EHQALIYKYM ASGVPIPSDL LLPLRRSFLL  60
DSALATSPSL AFPPQAALGW GCFGMGFGRK AEDPEPGRCR RTDGKKWRCS KEAYPDSKYC  120
EKHMHRGKNR SRKPVEMSLA TPPPPPSSSA SSSSSNVHSA VNVATTTTSP APSYHRHAAA  180
THDTT
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3538130.0AK353813.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1002P02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020156076.11e-132growth-regulating factor 1-like isoform X1
SwissprotQ6AWY89e-81GRF1_ORYSJ; Growth-regulating factor 1
TrEMBLA0A1D6S7X51e-131A0A1D6S7X5_WHEAT; Growth regulating factor 1-A1
TrEMBLA0A446VQE91e-131A0A446VQE9_TRITD; Uncharacterized protein
STRINGTraes_6AL_F5BFFCA3E.11e-135(Triticum aestivum)
STRINGTraes_6DL_4C3F04219.11e-131(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57413652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.16e-49growth-regulating factor 5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]