PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6AL_065306054.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 306aa    MW: 32917.2 Da    PI: 8.7899
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6AL_065306054.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.15.2e-4060120262
                 zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                            +++ lkcprCdst+tkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk++s
  Traes_6AL_065306054.1  60 HDQPLKCPRCDSTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGSLRNVPVGGGCRKNKRAS 120
                            7899******************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-2858113IPR003851Zinc finger, Dof-type
PfamPF027012.5E-3361118IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.35764118IPR003851Zinc finger, Dof-type
PROSITE patternPS01361066102IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MRNAWRMVER SRPSRQVHYG IVPEDQGGMG SSSPSEELII ACPEPMQAQQ AADRRLRPQH  60
DQPLKCPRCD STHTKFCYYN NYSLSQPRYF CKTCRRYWTK GGSLRNVPVG GGCRKNKRAS  120
AAKKPSAAAV ITPPISMMQQ LHHGRHMAET GLHLSFSGMQ PPAVSAADPL CSLGLFDWKY  180
DHILSGSGGF ESANSEAHFT GPGMMGIANG SGGGGAEYHA LNALRYAAGL GEHLALPFGG  240
ATSRAERDSV VAEMKPQAER LLSLEWCGEA SRAPTETSIS SLGGLGLWSG MITGATHHHH  300
GSSAAI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3763880.0AK376388.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3122H18.
GenBankAM0843600.0AM084360.1 Hordeum vulgare subsp. vulgare dof12 gene for dof zinc finger protein 12, exons 1-2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020196058.10.0dof zinc finger protein DOF1.6-like
TrEMBLA0A3B6NSV50.0A0A3B6NSV5_WHEAT; Uncharacterized protein
STRINGTraes_6AL_065306054.10.0(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.13e-36Dof family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]