PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5DL_4F38323F3.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 822aa    MW: 91564 Da    PI: 10.2875
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5DL_4F38323F3.3genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.37.4e-08252296246
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            ++WT+ E+++l+  v++ G+++W  Ia  +g+ Rt+ qc  r+q 
  Traes_5DL_4F38323F3.3 252 KAWTACEEKRLILTVQEKGMHNWINIAVALGTQRTPFQCLARYQR 296
                            58*****************************99**********96 PP

2Myb_DNA-binding422.2e-13305349248
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              WT+eEd++l+ av+ +G + W ++++ +  gR ++qc +r++k l
  Traes_5DL_4F38323F3.3 305 RTWTKEEDLQLLAAVQTFGCN-WQLVSANLV-GRIGNQCSNRYRKTL 349
                            68*****************88.*********.************975 PP

3Myb_DNA-binding43.95.5e-14357402248
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            grW+++Ed++l   vk++ +g+W++Ia+ ++ gRt  qc +rw+++l
  Traes_5DL_4F38323F3.3 357 GRWSEDEDKRLMVSVKLFRSGSWNKIAQFVP-GRTQSQCSERWRNVL 402
                            8******************************.************986 PP

4Myb_DNA-binding33.97.1e-11409452246
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            g W +eEd +l+  v++ G+  W++Ia  m  +Rt+++c  rw  
  Traes_5DL_4F38323F3.3 409 GEWRPEEDSKLLASVHEVGPC-WSKIAGAMIPHRTDNMCLRRWKR 452
                            79*****************88.*****99999***********86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.808147245IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.602.9E-5149170IPR009057Homeodomain-like
SMARTSM007170.21151247IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-5217232IPR009057Homeodomain-like
SuperFamilySSF466896.01E-5220263IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.6E-6233265IPR009057Homeodomain-like
PROSITE profilePS500908.072246298IPR017877Myb-like domain
SuperFamilySSF466891.45E-19250345IPR009057Homeodomain-like
SMARTSM007174.9E-4250300IPR001005SANT/Myb domain
PfamPF002492.5E-6252296IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-13266306IPR009057Homeodomain-like
PROSITE profilePS5129419.246299353IPR017930Myb domain
SMARTSM007172.1E-12303351IPR001005SANT/Myb domain
PfamPF002496.0E-12305348IPR001005SANT/Myb domain
CDDcd001672.91E-9306349No hitNo description
Gene3DG3DSA:1.10.10.602.5E-15307349IPR009057Homeodomain-like
PROSITE profilePS5009010.557351402IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.608.1E-19352404IPR009057Homeodomain-like
SuperFamilySSF466899.71E-25353450IPR009057Homeodomain-like
SMARTSM007171.8E-11355404IPR001005SANT/Myb domain
CDDcd001671.22E-10358402No hitNo description
PfamPF139213.8E-14359419No hitNo description
PROSITE profilePS5129417.042403458IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-15405457IPR009057Homeodomain-like
SMARTSM007174.8E-10407456IPR001005SANT/Myb domain
CDDcd001678.34E-9410453No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 822 aa     Download sequence    Send to blast
MKNEASKGGD DEFIAHQPGE EDVQKKNMNA NTQTGFPKAA LLLVDALKKN RACQKFIRRK  60
MINIEAKIEV NKDLRDRVKC LMDYQYSCRR SFGKVLCQKV DPRVRLISSQ KQSAQSAKNK  120
YKTPALLLGP AENPHVEKYK AVLKQFPVSL QKHPWSDIEK DRLAKGIKQQ YQEALIKDSM  180
KNGSSSGDFS AVDMAYALTN TVGNFEATPE ILRSVLPLVN WDYVAAMYLP GRSGAECESR  240
WLNHDDPLIN HKAWTACEEK RLILTVQEKG MHNWINIAVA LGTQRTPFQC LARYQRSLNP  300
HILKRTWTKE EDLQLLAAVQ TFGCNWQLVS ANLVGRIGNQ CSNRYRKTLI PERKRVGRWS  360
EDEDKRLMVS VKLFRSGSWN KIAQFVPGRT QSQCSERWRN VLDPDIEHGE WRPEEDSKLL  420
ASVHEVGPCW SKIAGAMIPH RTDNMCLRRW KRLCQDELPL MIAANQVKKS IFQTNFVDRE  480
TERPAICPSD FPSLVYSKVD KGDENTVSDQ VKKPRKRSRK SSVDNVPPND PSKSSADAAA  540
VNTTKRKPRK KLSGIGAENQ TGEDITVSDG VNNSSRFHHS KARKRKVTTD GDVVVQPGMR  600
GSISVDKELT LDILGGPISF DNEAPTNQKR DPTSVGKEGT AKKRTRGSVS VGNEGAVKKK  660
MRGSISVGDG RAVKNRMRGS VSIDNQGNTT KRKRVSRKSA KGNSKTDGEV NTCEMDLPSV  720
PSEAAAERGI HTGNTNKMKR KSTPRPKLIN MAEGTVDEYS RLADCISFAR GNGTSKNNSV  780
MPINNAVQSG GPSGENLQVA ISARLDPTSV ENGSTPNTQV VD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C8e-232244753155MYB PROTO-ONCOGENE PROTEIN
1h89_C8e-232244753155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1511519KKPRKRSRK
2640646AKKRTRG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3685540.0AK368554.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2075O14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014752713.10.0PREDICTED: uncharacterized protein LOC100828457 isoform X5
TrEMBLW5FT600.0W5FT60_WHEAT; Uncharacterized protein
STRINGMLOC_5739.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.11e-141myb domain protein 4r1
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]