PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BS_ED54C58C5.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GRAS
Protein Properties Length: 743aa    MW: 81993.5 Da    PI: 5.45
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BS_ED54C58C5.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS350.72.3e-1073657371374
                   GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                            l++lL++cA+ v+++d + a++lL++++ +a pdgd +qRla++f+e+L+arla+++  + ++l +++ s    ++ l+a++l+  + 
  Traes_5BS_ED54C58C5.1 365 LRTLLIHCAQSVATDDRRSATELLKQIKLHARPDGDGTQRLAHCFAEGLQARLAGTGGLVHQSLMATRIS---AVDMLKAYQLYMAAI 449
                            6789***************************************************888888777777776...9************** PP

                   GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgv 174
                             + k+s+l  N++I++a  g++++HiiD++i++G+QWp++l+ +++Rp+gpp++RiTg++ p++g   +e++eetg+rL+k+A+e++v
  Traes_5BS_ED54C58C5.1 450 CFKKVSFLFSNSTIYNASLGKKKIHIIDYGIQYGFQWPCFLRRISTRPGGPPNVRITGIDLPQPGfrPTERIEETGRRLKKYAHEFNV 537
                            ****************************************************************9*********************** PP

                   GRAS 175 pfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfleale 262
                            pfe++++++ ++e+l+ e+L+++p+E+l+Vn+ +q ++l+desv les+rd vLk +++++P+ ++++  + + +++ F++rf e l 
  Traes_5BS_ED54C58C5.1 538 PFEYRAIATAKMESLRKEDLKIDPDEVLIVNSLFQFKNLMDESVVLESPRDVVLKNIRKMRPHTFIHAIVNGSFSAPFFVTRFREVLF 625
                            ******9999****************************************************************************** PP

                   GRAS 263 yysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyr 350
                            yysalfd l+++ pr++e+r+ +E+ +lgr++ nv+aceg++r+er et+++W+ r ++aG+k +pl+ ++ + a+  +++++ + + 
  Traes_5BS_ED54C58C5.1 626 YYSALFDVLDTTTPRDNEQRMLIEQNILGRAALNVIACEGTDRVERPETYKQWQVRNQRAGLKLLPLNPEVIELARDKVKNCYHKDFV 713
                            ***********************************************************************************889** PP

                   GRAS 351 veeesgslvlgWkdrpLvsvSaWr 374
                            ++ ++++l++gWk+r L+++S W+
  Traes_5BS_ED54C58C5.1 714 IDIDQHWLLQGWKGRILYAISTWT 737
                            ***********************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.353339717IPR005202Transcription factor GRAS
PfamPF035148.0E-105365737IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 743 aa     Download sequence    Send to blast
MGSSSYLPHD TDFSPYLPAD MGSPTADDPS LNLYLSDLIP GSPSEYLDLP PTPHHEQEHQ  60
KPSPDGHGGG VGGGGGDSPS STPEDLVLPF ISRILMEEDI DDKFFYDFPD NPALIEAQQP  120
FLEILSDPSS NSTSDDSNNR AVSPCSPSDA SVGTAAQLPP TPAAVDSYDR FQFEPVDLDP  180
AAFFGGGANS DLMSSAFLKG MQEANKFLPS QDKLVIDLEA SSGQFFKGVE EGNKFLPRED  240
KLVAGFNGHA APAPAPVVLS VKKEEAVDAV SANSGGGRGR KNPYHDDELE QEGGRSSKQS  300
ALGDDVSARE MFDRMLMPSD EMCIVQMQNL RIAMQEAVAK NDSGGGKGAN GKGRGRRGGS  360
DVVDLRTLLI HCAQSVATDD RRSATELLKQ IKLHARPDGD GTQRLAHCFA EGLQARLAGT  420
GGLVHQSLMA TRISAVDMLK AYQLYMAAIC FKKVSFLFSN STIYNASLGK KKIHIIDYGI  480
QYGFQWPCFL RRISTRPGGP PNVRITGIDL PQPGFRPTER IEETGRRLKK YAHEFNVPFE  540
YRAIATAKME SLRKEDLKID PDEVLIVNSL FQFKNLMDES VVLESPRDVV LKNIRKMRPH  600
TFIHAIVNGS FSAPFFVTRF REVLFYYSAL FDVLDTTTPR DNEQRMLIEQ NILGRAALNV  660
IACEGTDRVE RPETYKQWQV RNQRAGLKLL PLNPEVIELA RDKVKNCYHK DFVIDIDQHW  720
LLQGWKGRIL YAISTWTAND ASS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-433697368374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3579960.0AK357996.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1066L11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003579265.10.0PREDICTED: scarecrow-like protein 34
TrEMBLW5FPE20.0W5FPE2_WHEAT; Uncharacterized protein
STRINGMLOC_21297.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-160SCARECROW-like 14
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]