PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BL_9B80DEC84.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 963aa    MW: 106719 Da    PI: 9.0296
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BL_9B80DEC84.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.18.4e-08394438246
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            ++WT+ E+++l+  v++ G+++W  Ia  +g+ Rt+ qc  r+q 
  Traes_5BL_9B80DEC84.1 394 NAWTACEEKRLILTVQEKGMHNWINIAVALGTQRTPFQCLARYQR 438
                            68*****************************99**********96 PP

2Myb_DNA-binding431.1e-13447491248
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              WT+eEd++l+ av+ +G + W ++++ +  gR ++qc +r++k l
  Traes_5BL_9B80DEC84.1 447 RTWTKEEDLQLLAAVQTYGCN-WQLVSANLV-GRIGNQCSNRYRKTL 491
                            68*****************88.*********.************975 PP

3Myb_DNA-binding43.66.6e-14499544248
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            grW+++Ed++l   vk++ +g+W++Ia+ ++ gRt  qc +rw+++l
  Traes_5BL_9B80DEC84.1 499 GRWSEDEDKRLMVSVKLFRSGSWNKIAQFVP-GRTQSQCSERWRNVL 544
                            8******************************.************986 PP

4Myb_DNA-binding33.78.6e-11551594246
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            g W +eEd +l+  v++ G+  W++Ia  m  +Rt+++c  rw  
  Traes_5BL_9B80DEC84.1 551 GEWRPEEDSKLLASVHEVGPC-WSKIAGAMIPHRTDNMCLRRWKR 594
                            79*****************88.*****99999***********86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.901289387IPR017877Myb-like domain
SMARTSM007170.004293389IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.2E-6294326IPR009057Homeodomain-like
CDDcd001670.00816362386No hitNo description
Gene3DG3DSA:1.10.10.603.6E-6362407IPR009057Homeodomain-like
SuperFamilySSF466897.34E-15368436IPR009057Homeodomain-like
PROSITE profilePS500908.188388440IPR017877Myb-like domain
SMARTSM007176.0E-4392442IPR001005SANT/Myb domain
PfamPF002492.7E-6394438IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.3E-13408448IPR009057Homeodomain-like
SuperFamilySSF466891.79E-19426491IPR009057Homeodomain-like
PROSITE profilePS5129419.835441495IPR017930Myb domain
SMARTSM007175.8E-13445493IPR001005SANT/Myb domain
PfamPF002493.0E-12447490IPR001005SANT/Myb domain
CDDcd001677.73E-10448491No hitNo description
Gene3DG3DSA:1.10.10.601.9E-15449491IPR009057Homeodomain-like
PROSITE profilePS5009010.557493544IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.5E-18494547IPR009057Homeodomain-like
SuperFamilySSF466891.2E-24495592IPR009057Homeodomain-like
SMARTSM007171.8E-11497546IPR001005SANT/Myb domain
CDDcd001671.06E-10500544No hitNo description
PfamPF139214.6E-14501561No hitNo description
PROSITE profilePS5129417.042545600IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-15548599IPR009057Homeodomain-like
SMARTSM007174.8E-10549598IPR001005SANT/Myb domain
CDDcd001677.14E-9552595No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 963 aa     Download sequence    Send to blast
MDFYSDDDSD PDFDEGLQED LDLVRRSCII AGADPDAAVA QASSYLAVPS ATTTAAAAAA  60
AARDGSSDEG EGEEEDEDLA LVRSIRENLH LNKASPSSPR PICAWPPSDA EDDEEDDLET  120
LRAIQRRFSH YHSGTSTGPL ENMKNEASKG GNDEFIAHRP GEEDAQKKNM NANTQTGFPK  180
AALLLVDALK KNRACQKFIR RKMINIEAKI EVNKDLRDRV KCLMDYQYSC RRSFGKVLCQ  240
KVDPRVRLIS SQKQSAQSAK NKYKMPALLL GPAENPHVEK YKAVLKQFPV SLQKHPWSDI  300
EKDRLAKGIK QQYQEALIKD SMKNGSSSGD FSAVDMAYAL TNTVGNFEAT PEILRSVLPL  360
VNWDFIAAMY LPGRSGAECE SRWLNHDDPL INHNAWTACE EKRLILTVQE KGMHNWINIA  420
VALGTQRTPF QCLARYQRSL NPHILKRTWT KEEDLQLLAA VQTYGCNWQL VSANLVGRIG  480
NQCSNRYRKT LIPERKRVGR WSEDEDKRLM VSVKLFRSGS WNKIAQFVPG RTQSQCSERW  540
RNVLDPDIEH GEWRPEEDSK LLASVHEVGP CWSKIAGAMI PHRTDNMCLR RWKRLCQDEL  600
PLMIAANQVK KSIFQTNFVD RETERPAICP SDFPSLVYSK VDKGDENTVS DQVKKPRKRS  660
RKSSVDNVPP NDPSKSSADA AAVNTTKRKS RKKLSGIGAE NQTGEDITVS DGVNNSSRGH  720
SRARKRKVTT DGDVVVQTRM RGSISVDNEL TLDILGGPIS FDDEAPTNQK RDPTSVGKEG  780
TAKKRTRGSV SVGNEGPVKK KMRGSISVGD GRAVKNRMRG SVSIDNQGNT TKRKRVSRKS  840
AKGNSKTDGE VNTCEMDLPS VPSEAAAERG IDTGNTNKMK RKSTPRPKLI NMAEGTVDEY  900
SRLADCISFA RGNGTSKNNS VMPINNAMQS GGPSGENLQV AISARLDPTS IENGSSPNTQ  960
VVD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C6e-233626173155MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-233626173155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1653661KKPRKRSRK
2781787AKKRTRG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3685540.0AK368554.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2075O14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014752713.10.0PREDICTED: uncharacterized protein LOC100828457 isoform X5
TrEMBLW5FFF80.0W5FFF8_WHEAT; Uncharacterized protein
STRINGMLOC_5739.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.11e-142myb domain protein 4r1
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]