PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BL_6E13A3C8C.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family G2-like
Protein Properties Length: 451aa    MW: 46023 Da    PI: 7.4509
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BL_6E13A3C8C.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.4e-32258311255
                G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                            pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Traes_5BL_6E13A3C8C.1 258 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 311
                            9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.51E-15255312IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-28256312IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-23258311IPR006447Myb domain, plants
PfamPF002498.3E-7259310IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MEASSAASPD LSLHISLPST GPPTGPGGGG GGRGPVGGGG GDPWRRLNGS TASTELSLSP  60
PLLAADQEGA ALPWRHRPSS SAAASSAATT SAQAALMTMP MLQPLDAGVG GASAAPPIRG  120
IPIYNGAGGF PFLPPAPGGG EGHHLPKVGF YSYHHPAAWP SSLGSTSPSS LGPGPAPPAN  180
SFDPTAAFLS SAAHHRMLSA SGRLNGMLSD TLRSYGAPGG GVGMGLGGHH HHLHGAQPFG  240
LGSRFMPKLP AKRSMRAPRM RWTSTLHARF VHAVELLGGH ERATPKSVLE LMDVKDLTLA  300
HVKSHLQMYR TVKSTDKPAA SGPTDGGSGD DDFPSAGGQV GSGGDNNMCP RPFPEHRSTS  360
EGAASSVGGG GDMDQSSAGN ASTKWSNSSR DPWVSSNSCN MDAHRSIGLS SPMENMEPCR  420
STGSQVSNHE LSSPSLEFTL GRPDWHGADH D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-16259313357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-16259313357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-16259313357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-16259313357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13038GGRGPVGGG
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3771030.0AK377103.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3148F08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020150556.10.0probable transcription factor RL9
SwissprotQ0J2351e-165ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A3B6LLY90.0A0A3B6LLY9_WHEAT; Uncharacterized protein
TrEMBLA0A446U9C10.0A0A446U9C1_TRITD; Uncharacterized protein
STRINGTraes_5BL_6E13A3C8C.10.0(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.11e-52G2-like family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]