PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BL_6054E8EC9.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family ZF-HD
Protein Properties Length: 94aa    MW: 9841.97 Da    PI: 7.3403
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BL_6054E8EC9.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer941.2e-292881358
            ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                            v+YkeC++NhAa +Gg+avDGC+Efm+s    + a+al CaACgCHR+FH+reve
  Traes_5BL_6054E8EC9.1 28 VVHYKECQRNHAAGIGGYAVDGCREFMASAP--AGAEALLCAACGCHRSFHKREVE 81
                           689*************************944..459*****************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-112792IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.8E-262980IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.3E-233080IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.1513179IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 94 aa     Download sequence    Send to blast
MGPQQDRSAS KALANGTAVA PERKDGKVVH YKECQRNHAA GIGGYAVDGC REFMASAPAG  60
AEALLCAACG CHRSFHKREV EAVDCDCSSD TSGR
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3604211e-146AK360421.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1117M15.
GenBankAK3613571e-146AK361357.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1138M11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020160851.11e-63mini zinc finger protein 1-like
SwissprotB8BIU82e-32MIF1_ORYSI; Mini zinc finger protein 1
SwissprotQ2RB282e-32MIF1_ORYSJ; Mini zinc finger protein 1
TrEMBLA0A446U3C73e-62A0A446U3C7_TRITD; Uncharacterized protein
TrEMBLA0A453KBU43e-62A0A453KBU4_AEGTS; Uncharacterized protein
TrEMBLF2D9593e-62F2D959_HORVV; Predicted protein
TrEMBLW5FC483e-62W5FC48_WHEAT; Uncharacterized protein
STRINGTraes_5BL_6054E8EC9.15e-63(Triticum aestivum)
STRINGTraes_5DL_1F0881CE1.15e-63(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.12e-17mini zinc finger 2
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]