PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5AL_78AD0AF8E.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 822aa    MW: 91737.8 Da    PI: 10.2354
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5AL_78AD0AF8E.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.46.9e-08250294246
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            ++WT+ E+++l+  v++ G+++W  Ia  +g+ Rt+ qc  r+q 
  Traes_5AL_78AD0AF8E.1 250 NAWTACEEKRLILTVQEKGMHNWINIAVALGTQRTPFQCLARYQR 294
                            68*****************************99**********96 PP

2Myb_DNA-binding45.22.1e-14303347248
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                             +WT+eEd++lv av+ +G + W ++++ +  gR ++qc +rw+k l
  Traes_5AL_78AD0AF8E.1 303 RAWTKEEDLQLVAAVQTFGCN-WQLVSASLV-GRIGNQCSNRWRKTL 347
                            68*****************88.*********.************975 PP

3Myb_DNA-binding43.29e-14355400248
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            grW+++Ed++l+  vk + +g+W++Ia+ ++ gRt  qc +rw+++l
  Traes_5AL_78AD0AF8E.1 355 GRWSEDEDKRLLVSVKFFRSGSWNKIAQFVP-GRTQSQCSERWRNVL 400
                            8******************************.************986 PP

4Myb_DNA-binding33.97.1e-11407450246
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            g W +eEd +l+  v++ G+  W++Ia  m  +Rt+++c  rw  
  Traes_5AL_78AD0AF8E.1 407 GEWRPEEDSKLLASVHEVGPC-WSKIAGAMIPHRTDNMCLRRWKR 450
                            79*****************88.*****99999***********86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.075147243IPR017877Myb-like domain
SMARTSM007170.049151245IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-7152184IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-7218263IPR009057Homeodomain-like
SuperFamilySSF466891.1E-15224292IPR009057Homeodomain-like
PROSITE profilePS500908.478244296IPR017877Myb-like domain
SMARTSM007176.0E-4248298IPR001005SANT/Myb domain
PfamPF002492.2E-6250294IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.0E-13264303IPR009057Homeodomain-like
SuperFamilySSF466893.87E-19282347IPR009057Homeodomain-like
PROSITE profilePS5129420.893297351IPR017930Myb domain
SMARTSM007172.0E-12301349IPR001005SANT/Myb domain
PfamPF002491.1E-12302346IPR001005SANT/Myb domain
CDDcd001672.70E-9304347No hitNo description
Gene3DG3DSA:1.10.10.604.6E-16304347IPR009057Homeodomain-like
PROSITE profilePS5009010.499349400IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.606.3E-18350402IPR009057Homeodomain-like
SuperFamilySSF466899.77E-25351448IPR009057Homeodomain-like
SMARTSM007177.5E-12353402IPR001005SANT/Myb domain
CDDcd001671.05E-10356400No hitNo description
PfamPF139212.1E-13357417No hitNo description
PROSITE profilePS5129417.351401456IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-15403455IPR009057Homeodomain-like
SMARTSM007174.4E-10405454IPR001005SANT/Myb domain
CDDcd001671.33E-8408451No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 822 aa     Download sequence    Send to blast
MKNEASKGGD DEFIAHRPGE EDVQKKDTNA NTQTGFPKAA LLLVDALKKN RACQKFIRRK  60
MINIEAKIEV NKDLRDRVKC LMDYQLSCRR SFGKVLCQKV DPRVRLISSQ KQSAQSAKNK  120
YKISALLLGP AENPHVEKYK AVLKQFPVSL QKHPWSDVEK DRLAKGIKQQ YQETLIKDSL  180
KNGSGDFSAV DMAYALTNTV GNFEATPEIL RSVLPLVNWD YIAAMYLPGR SGAECESRWL  240
NHDDPRINHN AWTACEEKRL ILTVQEKGMH NWINIAVALG TQRTPFQCLA RYQRSLNPHI  300
LKRAWTKEED LQLVAAVQTF GCNWQLVSAS LVGRIGNQCS NRWRKTLIPE RKRVGRWSED  360
EDKRLLVSVK FFRSGSWNKI AQFVPGRTQS QCSERWRNVL DPDIDHGEWR PEEDSKLLAS  420
VHEVGPCWSK IAGAMIPHRT DNMCLRRWKR LCQDELPLIV AANQVKKSIF QNNFVDRETE  480
RPAICPSDFP SLVYSKVDRG DESTVSDQVK KPQKRSRKSR VDNVPPNDPS KSSAAAAAVN  540
ITKRKSRKKL SGSGAENQTG EDVTVSDGVN NSSRGHSKAR KRKVTTDGDV VVQKRMRGSI  600
SVDNELTLDM FGGPISFNNE ALTNQKRDPT SVGKEGTAKK RTRGTVSVGN EGAVKKKMRG  660
SISVGEGRAV KNRMRGSVSI DNQGNTTKRK RVSRKSAKGN STTDGGVNAC ELDLPSMPSE  720
TSAERHIDTG NTNKMNRKST PRPKQINMAE GTVDEYSRLA DCISFARGNG ASKNNSAMPL  780
NNAIQSDGPS GENLQVAISA RLDPTSVEQL TEDSSCQLDD NH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C8e-242224713155MYB PROTO-ONCOGENE PROTEIN
1h89_C8e-242224713155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1508514VKKPQKR
2637643AKKRTRG
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3685540.0AK368554.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2075O14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014752713.10.0PREDICTED: uncharacterized protein LOC100828457 isoform X5
RefseqXP_014752711.10.0PREDICTED: uncharacterized protein LOC100828457 isoform X2
TrEMBLW5EYI70.0W5EYI7_WHEAT; Uncharacterized protein
STRINGMLOC_5739.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.21e-142myb domain protein 4r1
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]