PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4DS_F8FC0C699.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GRAS
Protein Properties Length: 799aa    MW: 87816.9 Da    PI: 6.6204
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4DS_F8FC0C699.6genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS330.33.7e-1014147891373
                   GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                            l++ L++cA+av++gd++  ++lL ++++++sp+gd++qRla +f+e+L+arla+++s++y++l +++ts   + e l a+kl+  +s
  Traes_4DS_F8FC0C699.6 414 LRTMLIHCAQAVATGDHRGSNELLRQIKQHSSPKGDATQRLAYCFAEGLEARLAGTGSHVYRSLVAKSTS---VGEFLRAYKLYMAAS 498
                            5789***************************************************************999...9************** PP

                   GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgv 174
                             + k+ ++   + I++a+ g++r+Hi+D+++++G+QWp Llq La+R++gpp++RiTg++ p++g   + ++eetg+rL+k A+e+gv
  Traes_4DS_F8FC0C699.6 499 SFKKVNFIFVGKIIMDAMVGKSRLHIVDYNVEYGFQWPGLLQMLAEREGGPPEVRITGIDVPQPGfrPAFQIEETGRRLSKCAQEFGV 586
                            ****************************************************************999********************* PP

                   GRAS 175 pfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles.....erdevLklvkslsPkvvvvveqeadhnsesFlerf 257
                            pf+++  +  +le+++ e+L+++p E+l+V +++   +l+desv ++      +rd vL  +++++P+v++ +  +  ++++ F++rf
  Traes_4DS_F8FC0C699.6 587 PFKYHG-IPAKLETVHAEDLKIDPYEVLIVTSQYGFSNLMDESVIMDRqdipsPRDMVLTNIRKMRPDVFIDCVVNGTYSAPFFVTRF 673
                            ******.799******************************99987665556669********************************** PP

                   GRAS 258 lealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk 345
                             eal +ysa fd+l+a++pr++++r  +Er ++g+ + nv+acega+r+ r et+++W+ r ++aG+++vpls  ++k +k  ++  +
  Traes_4DS_F8FC0C699.6 674 REALFTYSAQFDMLDATIPRDNDDRLLIERDIFGPCALNVIACEGADRVDRPETYKQWQVRGHRAGLRQVPLSPAVVKLVKDKVKSLY 761
                            **************************************************************************************** PP

                   GRAS 346 sdgyrveeesgslvlgWkdrpLvsvSaW 373
                             + + ++ ++ +l++gWk+r L+++S W
  Traes_4DS_F8FC0C699.6 762 HKDFLIDVDNRWLLQGWKGRVLYAMSTW 789
                            888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.972388770IPR005202Transcription factor GRAS
PfamPF035141.3E-98414789IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 799 aa     Download sequence    Send to blast
MAATPDEFLR AGDAEPFSPS LFLDLPPTPS PPRAPASDDL DFISRMLMEE DIDDKFFYQY  60
PDHPAILSAQ HHFAQIISDS NTDDSANTAV ASSTFSSDSA TARSASSCSD SATNTGKSTS  120
SSHSATNTAH STSCSSSPGA FGPANPTWPY ERIDLSQPLH SPPYIGLGFP VDGANNLLFS  180
GVGTPTSGYF GHTPALSRGN NDHFVAPAGQ NGRSTGIQSF ATFANSSAAK DAKTLSNNGT  240
EKAAKPATQP ACRGGPGTPA SAFFNGQTNG DVDMLNMAFR KGMEEANKFL PTNNTLDAIS  300
NRPVPRDFTG DQLKKEEVDR LRMLMFSNGR GRKNRHGVED LEAEAGRRCK LMMPEQEETG  360
VGEMVEEIML HGHDIIMKGI EDLHIAMGTE AEKNHRKGTG KAARGRRGAS EVDLRTMLIH  420
CAQAVATGDH RGSNELLRQI KQHSSPKGDA TQRLAYCFAE GLEARLAGTG SHVYRSLVAK  480
STSVGEFLRA YKLYMAASSF KKVNFIFVGK IIMDAMVGKS RLHIVDYNVE YGFQWPGLLQ  540
MLAEREGGPP EVRITGIDVP QPGFRPAFQI EETGRRLSKC AQEFGVPFKY HGIPAKLETV  600
HAEDLKIDPY EVLIVTSQYG FSNLMDESVI MDRQDIPSPR DMVLTNIRKM RPDVFIDCVV  660
NGTYSAPFFV TRFREALFTY SAQFDMLDAT IPRDNDDRLL IERDIFGPCA LNVIACEGAD  720
RVDRPETYKQ WQVRGHRAGL RQVPLSPAVV KLVKDKVKSL YHKDFLIDVD NRWLLQGWKG  780
RVLYAMSTWV AGDHDNSKF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-374187898374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3649830.0AK364983.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2030A10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564369.10.0PREDICTED: scarecrow-like protein 34
TrEMBLW5ETZ60.0W5ETZ6_WHEAT; Uncharacterized protein
STRINGMLOC_74705.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-141GRAS family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]