PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4DS_C7C37A73D.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GRAS
Protein Properties Length: 674aa    MW: 75081.3 Da    PI: 6.1436
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4DS_C7C37A73D.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS341.21.8e-1042976682373
                   GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                             +lLl+cA+a+s+++ + a++lL+r++++++p+g++ qRla+yf+eAL arla+ +sely++l +++ts   +++ l+a +l+  ++ 
  Traes_4DS_C7C37A73D.1 297 HTLLLNCAQALSTDNRRTASELLKRIRQHSTPKGNAAQRLAHYFAEALDARLAGRGSELYQSLMARRTS---VADFLKANQLYMAACC 381
                            679**************************************************************9999...**************** PP

                   GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvp 175
                            + k++++ aN++I +av g++r+Hi+D+++sqGlQWp Ll+ La+R++gpp+++iTg++ p++g   +  +eetg+rL++fA+ +gvp
  Traes_4DS_C7C37A73D.1 382 CKKVAFIFANKTICNAVVGKSRLHIVDYGLSQGLQWPGLLRMLAAREGGPPEVKITGIDLPQPGfhGAYHIEETGRRLSNFARVFGVP 469
                            ***************************************************************999999******************* PP

                   GRAS 176 fefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerfleal 261
                            f+f+  +a + e++++e+L+++++E+l+V +  +   l+de++  +   +rd+vL+ +++++P+v+++   + +++++ Fl+rf eal
  Traes_4DS_C7C37A73D.1 470 FKFHG-IAAKRETVQPEDLNIDRDEVLVVISLCHFRLLMDENLGFDTpsPRDQVLNNIRKMRPDVFIHGIMNGSYGATYFLTRFREAL 556
                            *****.69999**********************9999999998655444*************************************** PP

                   GRAS 262 eyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgy 349
                              ysa fd l+a++pr++e r  +Er ++gr++ nv+acega+r+er et+++W+ r ++aG++++pl+ +++  +   ++  + + +
  Traes_4DS_C7C37A73D.1 557 FNYSAQFDLLDATVPRDNEGRLLLERDIFGRSALNVIACEGADRVERPETYKQWQLRNHRAGLRQLPLNPDVVRLVLDKVKDNYHKDF 644
                            *********************************************************************************999888* PP

                   GRAS 350 rveeesgslvlgWkdrpLvsvSaW 373
                             v+e++ +l+  Wk+r L+++S W
  Traes_4DS_C7C37A73D.1 645 VVDEDQRWLLHRWKGRVLYALSTW 668
                            ************************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.873270649IPR005202Transcription factor GRAS
PfamPF035146.3E-102297668IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 674 aa     Download sequence    Send to blast
MAATPEEFLG QQGFLARLEP PSPSLFLGLP PTPRGEEDGD SSFDDMALPY ISRLLEEDME  60
DHFFYLYPNH PALLRAQLPF AQILVDVADS ASGSTSALSP SSSTSTFDAT ASTTPSATSP  120
YDAAIQISRP PYAQVLGLAS GSPDTQSSAL LSCDEEAQNP SSDFVIGNYL LPGDQDMLNL  180
AFLKGMEEAS KFLPPNSSLP AMKVDQVVGG ALAGAGLKKK RDTLDPDMGR ASKLMMPEQE  240
EDGARELFDE MMFQEHEICM KGVQQLRIPV DSEPGKNRRK KGRPRRDSSD SEMVDLHTLL  300
LNCAQALSTD NRRTASELLK RIRQHSTPKG NAAQRLAHYF AEALDARLAG RGSELYQSLM  360
ARRTSVADFL KANQLYMAAC CCKKVAFIFA NKTICNAVVG KSRLHIVDYG LSQGLQWPGL  420
LRMLAAREGG PPEVKITGID LPQPGFHGAY HIEETGRRLS NFARVFGVPF KFHGIAAKRE  480
TVQPEDLNID RDEVLVVISL CHFRLLMDEN LGFDTPSPRD QVLNNIRKMR PDVFIHGIMN  540
GSYGATYFLT RFREALFNYS AQFDLLDATV PRDNEGRLLL ERDIFGRSAL NVIACEGADR  600
VERPETYKQW QLRNHRAGLR QLPLNPDVVR LVLDKVKDNY HKDFVVDEDQ RWLLHRWKGR  660
VLYALSTWVA DNAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-423006688374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3664420.0AK366442.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2043B18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014758580.10.0PREDICTED: scarecrow-like protein 9 isoform X2
RefseqXP_003575618.10.0PREDICTED: scarecrow-like protein 9 isoform X2
TrEMBLW5ESW30.0W5ESW3_WHEAT; Uncharacterized protein
STRINGBRADI4G09180.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-135GRAS family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]