PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4DS_A5CD70F30.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GRAS
Protein Properties Length: 712aa    MW: 79096.1 Da    PI: 7.4839
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4DS_A5CD70F30.3genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS335.97.1e-1033357062373
                   GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                             +lLl+cA+a+s+++ + a +lL+r+++++sp+gd+ qRla+yf+++L+arla+ +sely++l  s+ s   +++ l+a +l+  ++ 
  Traes_4DS_A5CD70F30.3 335 HTLLLNCAQALSTDNRQSAIELLKRIRQHSSPKGDAGQRLAHYFANGLEARLAGRGSELYQSLLLSRIS---VADFLKANQLYMAACC 419
                            679************************************************************999998...**************** PP

                   GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvp 175
                            + k++++ a ++I +av+g++r+Hi+D++++qGlQWp Ll+ La+R++gpp++RiTg++ p++g   +  +eetg+rL++fA+ +gvp
  Traes_4DS_A5CD70F30.3 420 CKKVAYIFADKTICNAVAGKRRLHIVDYGLNQGLQWPGLLRMLAAREGGPPEVRITGIDLPQPGfhGAYHIEETGRRLSNFARVFGVP 507
                            ***************************************************************999999******************* PP

                   GRAS 176 fefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerfleal 261
                            f+f+  +  + e++++e+L+++++E+l+V +  q  +l+des+  +   +rd+vL+ +++++P+v+++   + +++++sFl+rf eal
  Traes_4DS_A5CD70F30.3 508 FKFRG-IPAKRETVRPEDLNIDRDEVLVVISLCQFRHLMDESLGFDGpsPRDQVLNNIRKMRPDVFIHGIMNGSYGATSFLTRFREAL 594
                            *****.69999*******************************98876669************************************** PP

                   GRAS 262 eyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgy 349
                             +ysa fd l++++pr++e r  +Er ++gr+  nv+acega+r+er et+++W+ r ++aG++++pl+ +++k +   ++  + + +
  Traes_4DS_A5CD70F30.3 595 FHYSAQFDLLDTTVPRDNEGRLLLERDIFGRSCLNVLACEGADRVERPETYKQWQLRNHRAGLRQLPLNPEVVKLVLDKVKDNYHRNF 682
                            ************************************************************************************999* PP

                   GRAS 350 rveeesgslvlgWkdrpLvsvSaW 373
                             v+ ++ +l+  Wk+r L++ S+W
  Traes_4DS_A5CD70F30.3 683 VVDADQRWLLHRWKGRVLYAWSSW 706
                            ************************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.384308687IPR005202Transcription factor GRAS
PfamPF035142.5E-100335706IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 712 aa     Download sequence    Send to blast
MLPSHPILLK KKKCSGVMSN AALIATLLQW QVPTRSAMAA TPEEFLGQQG FLARLEPPSP  60
SLFLDLPPTP RDDDGHSSFD DMVLPYISRL LMEEGTEDHL FYLYPNHPAV LRAQQPFAQI  120
LVDVADSASA SGSTSSPSPS SSSDATASTT PSTATASASA SPDDAPVQIS RPPYTDVNGH  180
ASASPDNHSS GLLNGDEMAK RPSSDFFSHL LPGDQDMLNL AFRKGMEEAS KFLPPDISLP  240
PINEGTVVGG GNAVSLKKKR AALPLEPDVG RPSKLMMPEQ EERKMFDEMM FQEHEICMKG  300
THNLIAAADG EPGKNSRKKD RSRKAVDDRE MVDLHTLLLN CAQALSTDNR QSAIELLKRI  360
RQHSSPKGDA GQRLAHYFAN GLEARLAGRG SELYQSLLLS RISVADFLKA NQLYMAACCC  420
KKVAYIFADK TICNAVAGKR RLHIVDYGLN QGLQWPGLLR MLAAREGGPP EVRITGIDLP  480
QPGFHGAYHI EETGRRLSNF ARVFGVPFKF RGIPAKRETV RPEDLNIDRD EVLVVISLCQ  540
FRHLMDESLG FDGPSPRDQV LNNIRKMRPD VFIHGIMNGS YGATSFLTRF REALFHYSAQ  600
FDLLDTTVPR DNEGRLLLER DIFGRSCLNV LACEGADRVE RPETYKQWQL RNHRAGLRQL  660
PLNPEVVKLV LDKVKDNYHR NFVVDADQRW LLHRWKGRVL YAWSSWIAAD AT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-423387068374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3672260.0AK367226.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2053C24.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575618.10.0PREDICTED: scarecrow-like protein 9 isoform X2
RefseqXP_014758580.10.0PREDICTED: scarecrow-like protein 9 isoform X2
TrEMBLA0A096URM80.0A0A096URM8_WHEAT; Uncharacterized protein
STRINGMLOC_7746.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-136SCARECROW-like 14
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]