PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4DS_82065CB2C.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GRAS
Protein Properties Length: 521aa    MW: 58670.7 Da    PI: 6.7332
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4DS_82065CB2C.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS331.22e-1011435122373
                   GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                             +lL++cA+av + d + a +lL++++++asp+gd++qRla  f+e+L+arl++++s++y  l+++ ts   ++++++a++lf  ++ 
  Traes_4DS_82065CB2C.1 143 HTLLIHCAKAVMD-DRRSAGELLKEIKQHASPTGDATQRLAYWFAEGLEARLTGTGSQVYGLLTAECTS---TVRHMQAYQLFMSTCC 226
                            679********97.8999******************************************999998888...899************* PP

                   GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvp 175
                            + k+++l aN+aI +a+ g++r+Hi+D+++  G+QWp Ll+ LasR++gpp++RiT v+ p++g   ++ +e++g+rL+++A+elgvp
  Traes_4DS_82065CB2C.1 227 FRKVAFLFANKAIFNAAVGKSRLHIVDYGLHSGFQWPELLRWLASRDGGPPEVRITHVELPQPGvyPEKHMEQIGNRLTDIAQELGVP 314
                            **************************************************************************************** PP

                   GRAS 176 fefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerfleal 261
                            f++++ ++ +++++ +e+L+++p+EalaVn +++  +l+desv ++s  +rd+vL  + +++P+v+v +  + ++ ++ Fl rf eal
  Traes_4DS_82065CB2C.1 315 FKYRA-IMAQWQTICVEDLDMEPDEALAVNDQFNFRTLMDESVVIASpnPRDAVLGNISKMKPDVFVQSTVNGSY-GTFFLSRFREAL 400
                            *****.6999*********************************9998889***********************99.789********* PP

                   GRAS 262 eyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgy 349
                             y+salfd+l+a++pres+ r  +Er ++g+ + n++a eg++r+er et+++W+ r ++aG++++pl+ +++k a+ ++   + + +
  Traes_4DS_82065CB2C.1 401 FYHSALFDMLDATMPRESKLRLALERDVFGWMVLNAIAYEGEDRVERGETYKHWQIRNQRAGLRQLPLNRETVKMARDMVMGEYHKDF 488
                            *****************************************************************************9998888788* PP

                   GRAS 350 rveeesgslvlgWkdrpLvsvSaW 373
                             ++e++++l++gWk+r L++ S W
  Traes_4DS_82065CB2C.1 489 DIDEDHQWLLQGWKGRILYAHSTW 512
                            ************************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.77116493IPR005202Transcription factor GRAS
PfamPF035146.9E-99143512IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 521 aa     Download sequence    Send to blast
MHASTLMADQ GGALALDVHS PSSPIFKFKG VDEVRSLLLL PDGDYSTHMF STAFLRGMEE  60
ANKFLPTNCE LTTTGGHDQP KEKSGRGRKD RHGEVEADVS RTSRLVEAGA GEVFDQMLTA  120
MGNETGNSNK KGRKSKARVV DLHTLLIHCA KAVMDDRRSA GELLKEIKQH ASPTGDATQR  180
LAYWFAEGLE ARLTGTGSQV YGLLTAECTS TVRHMQAYQL FMSTCCFRKV AFLFANKAIF  240
NAAVGKSRLH IVDYGLHSGF QWPELLRWLA SRDGGPPEVR ITHVELPQPG VYPEKHMEQI  300
GNRLTDIAQE LGVPFKYRAI MAQWQTICVE DLDMEPDEAL AVNDQFNFRT LMDESVVIAS  360
PNPRDAVLGN ISKMKPDVFV QSTVNGSYGT FFLSRFREAL FYHSALFDML DATMPRESKL  420
RLALERDVFG WMVLNAIAYE GEDRVERGET YKHWQIRNQR AGLRQLPLNR ETVKMARDMV  480
MGEYHKDFDI DEDHQWLLQG WKGRILYAHS TWVAEGASSH C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-451465128374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014758581.10.0PREDICTED: scarecrow-like protein 14
TrEMBLW5ERC80.0W5ERC8_WHEAT; Uncharacterized protein
STRINGMLOC_43730.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-131GRAS family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]