PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4DS_352C41430.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family B3
Protein Properties Length: 648aa    MW: 72153.9 Da    PI: 8.9962
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4DS_352C41430.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B349.57.8e-16791581398
                            TT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                     B3  13 sgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                              rl +p +f  ++ + ++++   ++l+ +sg++W  +l      ++ ++ kGWkeFv+++ ++ g f++F++dgrs+f   v +f+
  Traes_4DS_352C41430.2  79 GERLKIPPSFN-QYlQDQPTG--VVSLKGQSGNTWLAEL--ASDNEGLFFVKGWKEFVRDHSIEMGHFLTFRYDGRSKF--SVVIFD 158
                            5689******8.665777666..7***************..888888****************************9999..777776 PP

2B347.63.1e-15543633498
                            E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
                     B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91 
                            +++ s+v     l lp +f++e+   ++ +++l+l +++g+sW+v++ y   ++   l++GW +F  +n+L+  D++vF+l +  + +
  Traes_4DS_352C41430.2 543 IMKESYVYVGFFLNLPCEFVRECL--PRAHRKLKLWNPQGKSWDVNYVYYSERCVGGLSGGWGKFSLDNNLEKFDVCVFELFS--KDN 626
                            678899999999***********5..345568***************887777777899*********************875..444 PP

                            .EEEEE- CS
                     B3  92 lvvkvfr 98 
                             +v+++r
  Traes_4DS_352C41430.2 627 IKVHIYR 633
                            6888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.1E-1968158IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.1E-1969158IPR015300DNA-binding pseudobarrel domain
CDDcd100176.71E-1769158No hitNo description
SMARTSM010192.2E-1369160IPR003340B3 DNA binding domain
PfamPF023622.0E-1479158IPR003340B3 DNA binding domain
PROSITE profilePS5086313.3180160IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.107.7E-23531633IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.22E-22533633IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.337540635IPR003340B3 DNA binding domain
SMARTSM010198.4E-13540635IPR003340B3 DNA binding domain
CDDcd100174.92E-22542633No hitNo description
PfamPF023624.7E-13543633IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 648 aa     Download sequence    Send to blast
MVGNRRLELQ ERDRRRRQLQ ESAWREEQER ESREAAAAAA MAAADKERAR EKGKEKENGG  60
EGGKFGQQFA RVFLPQLYGE RLKIPPSFNQ YLQDQPTGVV SLKGQSGNTW LAELASDNEG  120
LFFVKGWKEF VRDHSIEMGH FLTFRYDGRS KFSVVIFDGM CIEKPSAFHA KPCKNLVVKI  180
ESGKGDMDIN AADPSQASAA PLEESNGTTR KRVTEMDADG STSKNRSSIL ENGMPEASAV  240
TCNVAPTSLN VDMNAADPPE AVVVPLEESN QTTRKRIREI DANDSALQKS LRVREIDANG  300
SALQKSLRVR EIDANDSALQ KSSRVREIDA NDSALQSSRV REIDANETAL HKSSRVREID  360
ANDSALHKSS RVREIDANDS ALHKSSRVRE IDANDSALQK SSRVREIDAN DSSLQKSSGL  420
REIDANDSAL QKSSIASDKD KKRCPAASVG TYKSASTSLD STEDSDSSSS MLEQSISCIK  480
SELTSPIRLG VSKDVARRGQ NSATGKRQLR VLSQRRLVTE IQKDNALLRA KQFKSKNPFG  540
LQIMKESYVY VGFFLNLPCE FVRECLPRAH RKLKLWNPQG KSWDVNYVYY SERCVGGLSG  600
GWGKFSLDNN LEKFDVCVFE LFSKDNIKVH IYRVVPEITP FLPGPGKK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A9e-1351363422142B3 domain-containing transcription factor VRN1
4i1k_B9e-1351363422142B3 domain-containing transcription factor VRN1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3659260.0AK365926.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2039A04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020166536.10.0B3 domain-containing protein Os11g0197600-like
SwissprotQ2R9D22e-77Y1176_ORYSJ; B3 domain-containing protein Os11g0197600
TrEMBLA0A3B6JHP80.0A0A3B6JHP8_WHEAT; Uncharacterized protein
STRINGTraes_4DS_352C41430.20.0(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44613766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66980.12e-16B3 family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]