PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4DS_2E95B3A30.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family CPP
Protein Properties Length: 787aa    MW: 85019 Da    PI: 6.9544
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4DS_2E95B3A30.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.44.5e-16476514240
                    TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                            ++k+C+CkkskClk+YCeCfaag++Cse C+C++C Nk 
  Traes_4DS_2E95B3A30.2 476 SCKRCSCKKSKCLKLYCECFAAGVYCSEPCSCQGCLNKP 514
                            689**********************************96 PP

2TCR49.21e-15561600140
                    TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                            ++k+gCnCkks+ClkkYCeC++ g+ Cs++C+Ce CkN+ 
  Traes_4DS_2E95B3A30.2 561 RHKRGCNCKKSSCLKKYCECYQGGVGCSNNCRCETCKNTF 600
                            589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011146.6E-17475516IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.145476601IPR005172CRC domain
PfamPF036388.9E-12478513IPR005172CRC domain
SMARTSM011141.6E-15561602IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.4E-11563599IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 787 aa     Download sequence    Send to blast
MDTPDRAAAP AAARAEDSPL FSFINSLSPI EPLKSAYSGN GLQAYHQSLN VTSVSSIFTS  60
PHHNAHKESK LSKSSFADYT ENELCMEDGT DKNKSPTSST AVRLFACTST ITRESHTMIT  120
CSVNEGIVDP PKGPNDFPQP GRFDSGSPDH NTAPCHGVSV RSDLKQDKCP KLETVQTTNN  180
TVEKRKCLFS SDMQLQDGCQ PAKENNEVMG CEWEDLVSVT SGELLAFDSS MDQHHTGVQL  240
AVNNAESCGY LLSKLAGGAD ISDRTHPATS SQAYYHEMVV GEDKTENGQL FPEDKKTILS  300
EEIQDNINEE NACIPLGCKV ETQQRGVRRR CLVFEAAGYS HRTVQKESVG DLSFSTCKGK  360
SSAQNHRNPG KTPSPHVFRG IGLHLNALAL TSKDKMACQD PLATALVPSL KTEQDVHGNL  420
LSAGGNFVHS GSGLLDLQMD NDDCSVGGFL GNDHNSSQSS SPPKKRRKSD NGDDDSCKRC  480
SCKKSKCLKL YCECFAAGVY CSEPCSCQGC LNKPIHEEIV LSTRKQIEFR NPLAFAPKVI  540
RMSEAGQETQ EDPKNTPASA RHKRGCNCKK SSCLKKYCEC YQGGVGCSNN CRCETCKNTF  600
GTRDVAVSAE NEEMKQEGDQ TESCEKEKEN DQQKANVHSE DHKLVELVVP ITPPLDVSSS  660
LLKQPNFSNA KPPRPCKARS GSSSRSSKAS ETVQSRKISK VGDSVFIEEM PDILREPSSP  720
GIVKTCSPNG KRVSPPHNAL SISPNRKGGR KLILKSIPSF PSLAGDTNGG SAICSSDSAT  780
ALALGPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1547859812120Protein lin-54 homolog
5fd3_B1e-1547859812120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1462468PKKRRKS
2463467KKRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3750970.0AK375097.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3085F14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020167196.10.0protein tesmin/TSO1-like CXC 3
TrEMBLA0A3B6JCA70.0A0A3B6JCA7_WHEAT; Uncharacterized protein
STRINGTraes_4DS_2E95B3A30.20.0(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.15e-91TESMIN/TSO1-like CXC 2
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]