PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4DS_2B4E99BE4.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GRAS
Protein Properties Length: 525aa    MW: 59161.9 Da    PI: 6.5153
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4DS_2B4E99BE4.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3199.6e-981455172374
                   GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                             +lL++cA+av + d ++a +lL++++++asp+gd++qRla  f+e+L+arl++++s++y +l+++ ts    + +  a++ f  ++ 
  Traes_4DS_2B4E99BE4.2 145 HTLLIHCAKAVMD-DRRRAGELLKEIQQHASPTGDATQRLAYWFAEGLEARLTGTGSQVYGTLTAKGTS---AVAHSEAYQEFISACC 228
                            679********97.999**********************************************999999...899999********** PP

                   GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvp 175
                            + ++s+l aN+aI +a+ g +r+Hi+D++  +G+QW  Ll+ La+R++gpp++RiT ++ p++g   ++ +ee+g rL+ +A+elgv+
  Traes_4DS_2B4E99BE4.2 229 FRNVSFLFANSAIFNAAVGRSRLHIVDYGFRYGFQWSELLRRLAARDGGPPEVRITHIDLPQPGfhPEKHMEEIGYRLTGIARELGVS 316
                            ***************************************************************9999********************* PP

                   GRAS 176 fefnvlvakrledleleeL..rvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerfle 259
                            f++++ +  +++++++e+L  +++p+E+laVn  ++  +l+desv + s  +rd+vL  + +++P+v+v +  + ++ ++ Fl rf e
  Traes_4DS_2B4E99BE4.2 317 FKYRA-ILAQWQTVSIEDLdlDLEPDEVLAVNDLYNFRTLMDESVVIGSpnPRDTVLGNISKMKPDVFVQSTVNGSY-GTFFLSRFRE 402
                            *****.6889999999998334566********************9988779***********************99.789******* PP

                   GRAS 260 aleyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksd 347
                            al +ysalfd+l+a++pre++ r  +Er ++g+ + n++a eg++r+er+et+++W+ r ++aG++++pl+ +++k a+ ++++ + +
  Traes_4DS_2B4E99BE4.2 403 ALFFYSALFDMLDATMPRENKLRLALERNIFGWVVLNAIAYEGTDRVERCETYKHWQVRNQRAGLRQLPLDRETVKMARDMVKNKYHK 490
                            ************************************************************************************9988 PP

                   GRAS 348 gyrveeesgslvlgWkdrpLvsvSaWr 374
                             + ++e++++l++gWk+r L++ S W+
  Traes_4DS_2B4E99BE4.2 491 DFLIDEDHHWLLQGWKGRILLAHSTWE 517
                            8*************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.736118497IPR005202Transcription factor GRAS
PfamPF035143.3E-95145517IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 525 aa     Download sequence    Send to blast
MHASTLMADQ GGALASDMHS PSSGISKFKG VDDVRSLLLL ANGEFSTDIF STAFLKGMEE  60
AKKFLPTNSE LTATGEQDQP KEKSSRGRKD WSDEVEADFS RTDRLVEAGA CEVFDLNQMC  120
SSMDNETGNS NKKGRKSKAR VIDLHTLLIH CAKAVMDDRR RAGELLKEIQ QHASPTGDAT  180
QRLAYWFAEG LEARLTGTGS QVYGTLTAKG TSAVAHSEAY QEFISACCFR NVSFLFANSA  240
IFNAAVGRSR LHIVDYGFRY GFQWSELLRR LAARDGGPPE VRITHIDLPQ PGFHPEKHME  300
EIGYRLTGIA RELGVSFKYR AILAQWQTVS IEDLDLDLEP DEVLAVNDLY NFRTLMDESV  360
VIGSPNPRDT VLGNISKMKP DVFVQSTVNG SYGTFFLSRF REALFFYSAL FDMLDATMPR  420
ENKLRLALER NIFGWVVLNA IAYEGTDRVE RCETYKHWQV RNQRAGLRQL PLDRETVKMA  480
RDMVKNKYHK DFLIDEDHHW LLQGWKGRIL LAHSTWEADG ASSHC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-411485168374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014758581.10.0PREDICTED: scarecrow-like protein 14
TrEMBLR7W4N30.0R7W4N3_AEGTA; Uncharacterized protein
STRINGMLOC_43730.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-124SCARECROW-like 14