PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4DL_F6ADA799C.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 115aa    MW: 13514.2 Da    PI: 6.5534
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4DL_F6ADA799C.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.23.7e-2064115556
                            SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            +++  eq+++Le+ Fe +++++ e+++++A+ lgL  rqV vWFqNrRa++k
  Traes_4DL_F6ADA799C.1  64 RRLALEQVRALERSFETDNKLDPERKARIARDLGLHPRQVAVWFQNRRARWK 115
                            467789*********************************************9 PP

2HD-ZIP_I/II89.34.7e-2962115255
            HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtk 55 
                            kkrrl+ eqv++LE+sFe+++kL+perK+++ar+Lgl+prqvavWFqnrRAR+k
  Traes_4DL_F6ADA799C.1  62 KKRRLALEQVRALERSFETDNKLDPERKARIARDLGLHPRQVAVWFQNRRARWK 115
                            9****************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.63E-1858115IPR009057Homeodomain-like
SMARTSM003892.4E-1360115IPR001356Homeobox domain
CDDcd000867.20E-1462115No hitNo description
PROSITE profilePS5007116.63362115IPR001356Homeobox domain
PfamPF000462.0E-1763115IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.6E-2069115IPR009057Homeodomain-like
PRINTSPR000311.0E-58897IPR000047Helix-turn-helix motif
PROSITE patternPS00027092115IPR017970Homeobox, conserved site
PRINTSPR000311.0E-597113IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 115 aa     Download sequence    Send to blast
MKRQIKRPTR SQESPEPGEK LAFAEKENLL AAYMEHDEPE LAEADEEEEE EERAMSCGLG  60
GKKRRLALEQ VRALERSFET DNKLDPERKA RIARDLGLHP RQVAVWFQNR RARWK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3539651e-161AK353965.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1004B20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020190062.13e-75homeobox-leucine zipper protein HOX13-like
SwissprotA2XDD61e-35HOX13_ORYSI; Homeobox-leucine zipper protein HOX13
TrEMBLA0A3B6JPW55e-75A0A3B6JPW5_WHEAT; Uncharacterized protein
TrEMBLA0A453IZ723e-75A0A453IZ72_AEGTS; Uncharacterized protein
STRINGTraes_4AL_99A941299.12e-74(Triticum aestivum)
STRINGTraes_4DL_F6ADA799C.15e-77(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.15e-25homeobox protein 6
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]