PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4DL_E6F4A32C9.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Nin-like
Protein Properties Length: 692aa    MW: 76981 Da    PI: 6.4204
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4DL_E6F4A32C9.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK87.11.5e-27374424252
                 RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                            ek++sl++l+k+F++++k+AAk+Lgvc+T+LKriCR++GI+RWP+Rkik++
  Traes_4DL_E6F4A32C9.1 374 EKTVSLQELRKHFAGSLKEAAKNLGVCPTTLKRICRHHGIDRWPSRKIKKV 424
                            689**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.688363444IPR003035RWP-RK domain
PfamPF020422.8E-25376424IPR003035RWP-RK domain
SuperFamilySSF542771.57E-22589681No hitNo description
Gene3DG3DSA:3.10.20.2403.1E-23594677No hitNo description
PROSITE profilePS5174522.391596678IPR000270PB1 domain
SMARTSM006662.4E-25596678IPR000270PB1 domain
PfamPF005645.7E-17597677IPR000270PB1 domain
CDDcd064071.60E-39597677No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 692 aa     Download sequence    Send to blast
MPVFERRTGA CLGVVELVMT TQKINYNAEI DNICNALKEV DLRGSDVSSD PRAQVVDTSY  60
RAIVPEIAHV LKAVCETHKL PLAQTWIPCV CQAKRASRHS DEKYKYCVST VDEACYVRDA  120
AMTGFHQACS EHHLFRGEGV VGTALGTNEP CFCPDITAYS KVQYPLSHYA KLFGLRAAVA  180
IRLRSVKTGS MDLILEFFLP NNCINSEEQG NMLNSLSNTI QQASCTLRVV GVKELANDGS  240
PETSSPTPPE VCDKPAEILD ELHTSGINVP ARTTSVDASE EVSSWIASLV DVQNNGVQGE  300
TDCGLPFGFR KQEDEGFSVT AGWPTSPVLV PEDKSFFPGF KKHEEYEAKG SPFSSDRSLS  360
NSDKAIEKRR TKIEKTVSLQ ELRKHFAGSL KEAAKNLGVC PTTLKRICRH HGIDRWPSRK  420
IKKVGHSLKK LQMVIDSVHG AEGTVRLSSL YENFTKTTWS ERELQGDLSY PASEQKVQLE  480
PSVPDRQCES RFSPRTSGSN SLSPTYSQSS NSSLGCSSDP KPQQQQSSAP QLAVKQEFFM  540
EENQSSTQMK AASHDELQLF TEEKPVTLCR SQSHMLFSEH KPMENMSGMQ EAKPDSLKIK  600
AMYGEERCIF RLQPSWGFEK LKEEIAKRFG ISWEVYDLKY LDDESEWVLL TCDADLLECI  660
DVYKSSSAKT VRISVNPAVQ PVLRGSFGHI QP
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020164886.10.0protein NLP1-like
SwissprotQ10S830.0NLP1_ORYSJ; Protein NLP1
TrEMBLA0A453J2100.0A0A453J210_AEGTS; Uncharacterized protein
STRINGTraes_4DL_E6F4A32C9.10.0(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110253241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.11e-163Nin-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]