PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4DL_2C27C34AF.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family G2-like
Protein Properties Length: 419aa    MW: 45129.4 Da    PI: 9.3851
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4DL_2C27C34AF.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1071e-33344398155
                G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                            k+r+rWtpeLHe+Fv+ v++LGGsekAtPk +l+lmkv+gLt++hvkSHLQkYR+
  Traes_4DL_2C27C34AF.2 344 KQRMRWTPELHECFVDSVNKLGGSEKATPKGVLKLMKVDGLTIYHVKSHLQKYRT 398
                            79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.796341401IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-31342400IPR009057Homeodomain-like
SuperFamilySSF466893.58E-17343398IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-25344398IPR006447Myb domain, plants
PfamPF002491.0E-8346397IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
ATHHPSRPSW PHGGRRGLSA KSRAHGAVGV RGAPPPGNWW ASSSSCAHQV PPPSLSSSIP  60
APSVATHRPS QNSPLLSSPP PKAAPIQQLP HNPTQEHIKI NLWERRNACP QFLMRRCDLR  120
QSHNSRVSGG MSSSLPILPN SLKETFHGPY NPQLTPMQRQ LTSDLVPLHQ SALPSATLHP  180
RAGAMRSSYA ASLGYSPNPL DSAPNHERQS MVAPFAPQPS DIEVFQTLSN NIPGGHTGAT  240
WFPGSADGLS DYGDNIPASG SQIQNGGPAV TSDVVAKQNE WWAEIMNDDW RDILDATAAD  300
PQSKSMVQPS NSAASQPAVN QPASSHGGEI CNVASPPNSN SAAKQRMRWT PELHECFVDS  360
VNKLGGSEKA TPKGVLKLMK VDGLTIYHVK SHLQKYRTAR YKPDLMEGTA EKRTTTEEL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-29343402160Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-29343402160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-29343402160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-29343402160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-29343402160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-29343402160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-29343402160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-29343402160Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in phosphate starvation signaling. Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes. Functionally redundant with PHR2 and PHR3 in regulating Pi starvation response and Pi homeostasis. {ECO:0000250|UniProtKB:Q10LZ1}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3575970.0AK357597.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv1057F14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020173453.10.0protein PHOSPHATE STARVATION RESPONSE 1-like isoform X1
SwissprotB8ANX91e-121PHR1_ORYSI; Protein PHOSPHATE STARVATION RESPONSE 1
TrEMBLA0A453I6J40.0A0A453I6J4_AEGTS; Uncharacterized protein
STRINGTraes_4DL_2C27C34AF.20.0(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19713789
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.12e-39phosphate starvation response 1
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]